Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CND6

Protein Details
Accession I1CND6   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
165-196STLKNTTIKKRLKDQQKKKSSKPTNRYNPFILHydrophilic
NLS Segment(s)
PositionSequence
173-185KKRLKDQQKKKSS
Subcellular Location(s) nucl 21, cyto_nucl 14.833, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MNNECTFCGSKEQINIKKPQTINNNEKKSELETVEVSDQRDFSDMEENEQQDENKKESNLLKKPIVKQQQKINRKRKGTTQTTNEEDEEPNYGLRKRRAIGKGVYLNEGNSYDDDEDEDEYIHDEEEADSDNNELGLMNYEEVSLNEEEENNDYEIYEPRAPSGSTLKNTTIKKRLKDQQKKKSSKPTNRYNPFILFNKEMRAKIKADNPGAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.6
3 0.57
4 0.62
5 0.6
6 0.6
7 0.61
8 0.62
9 0.66
10 0.69
11 0.73
12 0.66
13 0.65
14 0.59
15 0.52
16 0.48
17 0.39
18 0.32
19 0.25
20 0.27
21 0.3
22 0.3
23 0.27
24 0.23
25 0.21
26 0.19
27 0.19
28 0.16
29 0.13
30 0.2
31 0.18
32 0.22
33 0.26
34 0.26
35 0.26
36 0.27
37 0.26
38 0.23
39 0.26
40 0.24
41 0.23
42 0.22
43 0.25
44 0.31
45 0.4
46 0.41
47 0.43
48 0.47
49 0.51
50 0.55
51 0.6
52 0.64
53 0.61
54 0.6
55 0.64
56 0.68
57 0.73
58 0.79
59 0.8
60 0.78
61 0.77
62 0.74
63 0.74
64 0.73
65 0.72
66 0.7
67 0.67
68 0.65
69 0.62
70 0.61
71 0.53
72 0.45
73 0.36
74 0.28
75 0.23
76 0.17
77 0.14
78 0.13
79 0.14
80 0.17
81 0.19
82 0.22
83 0.21
84 0.29
85 0.32
86 0.35
87 0.35
88 0.37
89 0.4
90 0.38
91 0.38
92 0.3
93 0.27
94 0.23
95 0.22
96 0.15
97 0.09
98 0.09
99 0.07
100 0.07
101 0.07
102 0.07
103 0.07
104 0.06
105 0.06
106 0.05
107 0.06
108 0.06
109 0.06
110 0.05
111 0.05
112 0.05
113 0.05
114 0.07
115 0.06
116 0.06
117 0.06
118 0.06
119 0.06
120 0.06
121 0.05
122 0.04
123 0.05
124 0.06
125 0.06
126 0.06
127 0.06
128 0.07
129 0.07
130 0.1
131 0.08
132 0.08
133 0.08
134 0.09
135 0.09
136 0.11
137 0.12
138 0.1
139 0.1
140 0.09
141 0.1
142 0.12
143 0.15
144 0.16
145 0.14
146 0.15
147 0.17
148 0.17
149 0.18
150 0.23
151 0.24
152 0.25
153 0.29
154 0.32
155 0.38
156 0.42
157 0.48
158 0.51
159 0.52
160 0.54
161 0.6
162 0.66
163 0.7
164 0.77
165 0.8
166 0.82
167 0.86
168 0.89
169 0.89
170 0.91
171 0.9
172 0.9
173 0.89
174 0.89
175 0.89
176 0.88
177 0.85
178 0.79
179 0.73
180 0.69
181 0.64
182 0.59
183 0.53
184 0.47
185 0.49
186 0.5
187 0.48
188 0.45
189 0.43
190 0.4
191 0.42
192 0.47
193 0.49