Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1CQK8

Protein Details
Accession I1CQK8    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-33IHKRSLSKSQHLPNVRKKPKTQEVHKEVPDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013963  DASH_Dad2  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0042729  C:DASH complex  
GO:0072686  C:mitotic spindle  
GO:0000278  P:mitotic cell cycle  
Pfam View protein in Pfam  
PF08654  DASH_Dad2  
Amino Acid Sequences MDRIHKRSLSKSQHLPNVRKKPKTQEVHKEVPDDNVDSPNVQPSAKLDLPVEKVIESEETTKLKNSSGHLVKYFTDLSEKMKMLADEAETASKSMRNWEYVFSTMKSVNMQNEKILPLVKFDLDNQSTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.79
3 0.79
4 0.81
5 0.81
6 0.8
7 0.78
8 0.79
9 0.8
10 0.81
11 0.8
12 0.8
13 0.79
14 0.81
15 0.77
16 0.71
17 0.61
18 0.55
19 0.47
20 0.38
21 0.31
22 0.24
23 0.21
24 0.18
25 0.18
26 0.17
27 0.16
28 0.13
29 0.12
30 0.12
31 0.19
32 0.19
33 0.19
34 0.16
35 0.19
36 0.22
37 0.23
38 0.22
39 0.14
40 0.14
41 0.13
42 0.14
43 0.11
44 0.1
45 0.11
46 0.12
47 0.13
48 0.14
49 0.14
50 0.14
51 0.16
52 0.15
53 0.21
54 0.23
55 0.24
56 0.24
57 0.25
58 0.24
59 0.25
60 0.23
61 0.16
62 0.15
63 0.13
64 0.16
65 0.19
66 0.19
67 0.17
68 0.18
69 0.18
70 0.16
71 0.17
72 0.14
73 0.11
74 0.11
75 0.12
76 0.1
77 0.11
78 0.1
79 0.11
80 0.1
81 0.16
82 0.17
83 0.2
84 0.2
85 0.23
86 0.26
87 0.27
88 0.3
89 0.24
90 0.25
91 0.22
92 0.23
93 0.23
94 0.22
95 0.27
96 0.3
97 0.3
98 0.3
99 0.32
100 0.31
101 0.3
102 0.3
103 0.23
104 0.21
105 0.22
106 0.21
107 0.2
108 0.21
109 0.29