Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1C2K9

Protein Details
Accession I1C2K9    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
45-68LGNVSKYKSLRKKAMRERRKITEAHydrophilic
NLS Segment(s)
PositionSequence
54-64LRKKAMRERRK
Subcellular Location(s) nucl 17, cyto_nucl 13, cyto 7
Family & Domain DBs
Amino Acid Sequences MKIEYDGKIQVYEKYEKGGFFDTIIPEPQPVELSDSESSVTDFQLGNVSKYKSLRKKAMRERRKITEAAEELGKQRAQLNVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.27
4 0.28
5 0.27
6 0.23
7 0.19
8 0.22
9 0.19
10 0.19
11 0.2
12 0.17
13 0.14
14 0.14
15 0.13
16 0.11
17 0.09
18 0.11
19 0.1
20 0.13
21 0.13
22 0.13
23 0.13
24 0.12
25 0.13
26 0.1
27 0.09
28 0.07
29 0.06
30 0.06
31 0.11
32 0.12
33 0.12
34 0.15
35 0.16
36 0.18
37 0.21
38 0.3
39 0.33
40 0.4
41 0.48
42 0.54
43 0.63
44 0.72
45 0.8
46 0.82
47 0.83
48 0.84
49 0.83
50 0.79
51 0.71
52 0.63
53 0.61
54 0.53
55 0.46
56 0.41
57 0.34
58 0.3
59 0.33
60 0.3
61 0.21
62 0.22