Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CE45

Protein Details
Accession I1CE45   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
81-105NGYRKSLHKVPKFTKKTNRTSPPGFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFKPSFVAQGGLLWKNPFRMSATRKANVRKRLKAVDEVISVVAKSGVECKALTEALALPKESEMLPRDKYTVFSRTANGYRKSLHKVPKFTKKTNRTSPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.21
4 0.21
5 0.23
6 0.23
7 0.21
8 0.2
9 0.27
10 0.32
11 0.4
12 0.46
13 0.48
14 0.54
15 0.62
16 0.66
17 0.68
18 0.71
19 0.68
20 0.67
21 0.69
22 0.67
23 0.63
24 0.58
25 0.52
26 0.44
27 0.37
28 0.31
29 0.23
30 0.2
31 0.14
32 0.11
33 0.06
34 0.05
35 0.07
36 0.07
37 0.08
38 0.08
39 0.08
40 0.09
41 0.09
42 0.09
43 0.07
44 0.08
45 0.1
46 0.11
47 0.1
48 0.09
49 0.09
50 0.1
51 0.09
52 0.12
53 0.11
54 0.15
55 0.17
56 0.18
57 0.2
58 0.2
59 0.23
60 0.24
61 0.26
62 0.25
63 0.24
64 0.25
65 0.3
66 0.36
67 0.41
68 0.4
69 0.38
70 0.39
71 0.42
72 0.48
73 0.49
74 0.53
75 0.53
76 0.6
77 0.67
78 0.74
79 0.77
80 0.79
81 0.83
82 0.83
83 0.85
84 0.86
85 0.86