Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1C3M0

Protein Details
Accession I1C3M0    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
40-63LISPPSKKSKTTKKVRLMNGHNSMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR036322  WD40_repeat_dom_sf  
Amino Acid Sequences MNAEEPSAAQMFNPPFVYSLAISTDGNWIASSLGDSTIQLISPPSKKSKTTKKVRLMNGHNSMVNCL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.17
4 0.19
5 0.14
6 0.13
7 0.12
8 0.13
9 0.12
10 0.12
11 0.13
12 0.11
13 0.11
14 0.1
15 0.08
16 0.07
17 0.07
18 0.06
19 0.05
20 0.05
21 0.05
22 0.05
23 0.06
24 0.06
25 0.06
26 0.06
27 0.06
28 0.09
29 0.12
30 0.16
31 0.2
32 0.23
33 0.29
34 0.38
35 0.48
36 0.55
37 0.63
38 0.71
39 0.75
40 0.81
41 0.85
42 0.87
43 0.83
44 0.83
45 0.8
46 0.73
47 0.66