Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3RY20

Protein Details
Accession E3RY20    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
206-231VDNHKKPNPTRIKWFKKVGEKVHKSLHydrophilic
NLS Segment(s)
PositionSequence
217-224IKWFKKVG
Subcellular Location(s) mito 21.5, cyto_mito 12.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000456  Ribosomal_L17  
IPR036373  Ribosomal_L17_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pte:PTT_14366  -  
Pfam View protein in Pfam  
PF01196  Ribosomal_L17  
PROSITE View protein in PROSITE  
PS01167  RIBOSOMAL_L17  
Amino Acid Sequences MAGGHMKYRHLSRSSSHRQALLRNLVTSLFKHETIATTWHKAKEAQVLAEKLVTLGKKNTEATRRRAMQIFYEPNDLVPKLFGPIRERYANRPGGYTRILRIEPMKEDQAESAILELVDGPKDMRFAMTAKSLARRDPSQAFSPAVTTHVKKATQFRKNGVEDLRTMVETLRRAHKTGLDDRILPKPRSVYPEEAMKRDMHYFEEVDNHKKPNPTRIKWFKKVGEKVHKSLYGPKKPALVQGPVSHKENIKQIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.59
3 0.59
4 0.57
5 0.56
6 0.59
7 0.63
8 0.61
9 0.54
10 0.45
11 0.43
12 0.39
13 0.38
14 0.32
15 0.31
16 0.25
17 0.22
18 0.23
19 0.23
20 0.23
21 0.23
22 0.29
23 0.26
24 0.29
25 0.33
26 0.34
27 0.35
28 0.35
29 0.36
30 0.38
31 0.36
32 0.34
33 0.36
34 0.35
35 0.34
36 0.33
37 0.29
38 0.2
39 0.2
40 0.17
41 0.13
42 0.15
43 0.17
44 0.2
45 0.24
46 0.3
47 0.36
48 0.42
49 0.46
50 0.52
51 0.53
52 0.53
53 0.54
54 0.49
55 0.45
56 0.48
57 0.48
58 0.4
59 0.41
60 0.37
61 0.34
62 0.35
63 0.29
64 0.2
65 0.15
66 0.13
67 0.11
68 0.12
69 0.14
70 0.15
71 0.2
72 0.24
73 0.3
74 0.31
75 0.35
76 0.42
77 0.45
78 0.41
79 0.4
80 0.36
81 0.34
82 0.35
83 0.31
84 0.24
85 0.23
86 0.22
87 0.21
88 0.23
89 0.21
90 0.21
91 0.22
92 0.22
93 0.18
94 0.19
95 0.17
96 0.16
97 0.14
98 0.11
99 0.08
100 0.06
101 0.05
102 0.05
103 0.05
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.05
110 0.05
111 0.05
112 0.05
113 0.06
114 0.08
115 0.09
116 0.11
117 0.11
118 0.16
119 0.17
120 0.18
121 0.2
122 0.2
123 0.22
124 0.25
125 0.27
126 0.25
127 0.26
128 0.25
129 0.22
130 0.22
131 0.18
132 0.17
133 0.16
134 0.14
135 0.15
136 0.19
137 0.19
138 0.21
139 0.3
140 0.37
141 0.42
142 0.45
143 0.46
144 0.51
145 0.51
146 0.53
147 0.47
148 0.39
149 0.33
150 0.33
151 0.29
152 0.21
153 0.19
154 0.15
155 0.15
156 0.16
157 0.18
158 0.23
159 0.24
160 0.25
161 0.27
162 0.3
163 0.33
164 0.37
165 0.41
166 0.35
167 0.36
168 0.37
169 0.45
170 0.47
171 0.42
172 0.37
173 0.34
174 0.36
175 0.39
176 0.41
177 0.38
178 0.34
179 0.44
180 0.44
181 0.43
182 0.41
183 0.36
184 0.34
185 0.31
186 0.29
187 0.22
188 0.22
189 0.21
190 0.2
191 0.27
192 0.28
193 0.31
194 0.33
195 0.33
196 0.34
197 0.4
198 0.41
199 0.44
200 0.52
201 0.52
202 0.6
203 0.68
204 0.74
205 0.77
206 0.83
207 0.81
208 0.81
209 0.83
210 0.83
211 0.83
212 0.8
213 0.77
214 0.76
215 0.71
216 0.62
217 0.64
218 0.64
219 0.63
220 0.6
221 0.58
222 0.56
223 0.54
224 0.59
225 0.55
226 0.5
227 0.45
228 0.48
229 0.53
230 0.51
231 0.53
232 0.49
233 0.46
234 0.45