Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1C9W7

Protein Details
Accession I1C9W7    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
16-42SDLPIEIKPKPIKRKTKAPPIRYDIVSHydrophilic
NLS Segment(s)
PositionSequence
23-33KPKPIKRKTKA
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
Pfam View protein in Pfam  
PF13975  gag-asp_proteas  
CDD cd00303  retropepsin_like  
Amino Acid Sequences MPKQPIQATGSMEVDSDLPIEIKPKPIKRKTKAPPIRYDIVSDVMNQKADISVGDLMVAAPTLRRKLASACRPKRIPVTETSKETMAVIEEDDIHTTAVYSKINIGDKTVKVLVDCGAAKTCMSKSLADALGLEIDAASESVFTLGNGSKQPALGVIYDVPIEVQEDLIIPCTVEVLPACPAHLIIGNNWLNRAKAKIDFNSSTLKVSYKNKKAEIEIFFLRKNTPLPKISSYIQSYQHPISSTNSKETKKVHFDNDKTDSEDDEVEEESEESTDEESTEEEEVEDEEHSLLLLENDYKKDIQIKNLKNQCILEASSDGLTIPANSSKTIIIKKPKDELRGLMYSFEITSTKILQKTGILDPCHNFITNKKSLEIRIHNRSNDNIILDLGEEIGILEKLNLKEDTIIQAYDVEKNIHLCTMEMTEAMDKETSDEDKETLEAEKYITDRIGLAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.16
3 0.12
4 0.09
5 0.08
6 0.08
7 0.11
8 0.12
9 0.21
10 0.29
11 0.38
12 0.48
13 0.58
14 0.69
15 0.74
16 0.84
17 0.85
18 0.88
19 0.89
20 0.87
21 0.88
22 0.84
23 0.83
24 0.73
25 0.67
26 0.58
27 0.51
28 0.42
29 0.34
30 0.31
31 0.26
32 0.25
33 0.21
34 0.19
35 0.16
36 0.15
37 0.13
38 0.11
39 0.1
40 0.09
41 0.1
42 0.09
43 0.09
44 0.08
45 0.08
46 0.05
47 0.06
48 0.1
49 0.12
50 0.13
51 0.14
52 0.16
53 0.24
54 0.34
55 0.43
56 0.51
57 0.57
58 0.65
59 0.67
60 0.7
61 0.71
62 0.67
63 0.6
64 0.58
65 0.6
66 0.57
67 0.59
68 0.57
69 0.48
70 0.43
71 0.39
72 0.3
73 0.22
74 0.16
75 0.11
76 0.09
77 0.1
78 0.1
79 0.11
80 0.1
81 0.09
82 0.08
83 0.08
84 0.09
85 0.1
86 0.1
87 0.09
88 0.11
89 0.16
90 0.2
91 0.2
92 0.23
93 0.26
94 0.26
95 0.3
96 0.3
97 0.25
98 0.22
99 0.23
100 0.19
101 0.17
102 0.18
103 0.14
104 0.14
105 0.14
106 0.14
107 0.15
108 0.15
109 0.15
110 0.16
111 0.15
112 0.15
113 0.21
114 0.22
115 0.19
116 0.19
117 0.16
118 0.14
119 0.14
120 0.12
121 0.05
122 0.04
123 0.04
124 0.04
125 0.03
126 0.03
127 0.03
128 0.04
129 0.04
130 0.04
131 0.06
132 0.06
133 0.09
134 0.1
135 0.11
136 0.11
137 0.11
138 0.11
139 0.1
140 0.11
141 0.09
142 0.1
143 0.09
144 0.09
145 0.09
146 0.08
147 0.07
148 0.06
149 0.06
150 0.05
151 0.04
152 0.04
153 0.05
154 0.05
155 0.07
156 0.06
157 0.06
158 0.05
159 0.06
160 0.06
161 0.06
162 0.06
163 0.06
164 0.08
165 0.08
166 0.09
167 0.08
168 0.08
169 0.08
170 0.11
171 0.1
172 0.08
173 0.17
174 0.19
175 0.19
176 0.21
177 0.21
178 0.18
179 0.19
180 0.2
181 0.14
182 0.16
183 0.2
184 0.22
185 0.27
186 0.28
187 0.29
188 0.32
189 0.3
190 0.27
191 0.23
192 0.21
193 0.2
194 0.27
195 0.34
196 0.37
197 0.42
198 0.44
199 0.46
200 0.47
201 0.5
202 0.45
203 0.41
204 0.36
205 0.33
206 0.3
207 0.28
208 0.26
209 0.2
210 0.2
211 0.19
212 0.21
213 0.21
214 0.24
215 0.26
216 0.29
217 0.29
218 0.31
219 0.3
220 0.29
221 0.29
222 0.27
223 0.28
224 0.26
225 0.26
226 0.21
227 0.2
228 0.19
229 0.22
230 0.22
231 0.25
232 0.3
233 0.3
234 0.33
235 0.36
236 0.4
237 0.42
238 0.44
239 0.46
240 0.49
241 0.5
242 0.53
243 0.56
244 0.5
245 0.45
246 0.41
247 0.34
248 0.26
249 0.24
250 0.17
251 0.12
252 0.11
253 0.08
254 0.08
255 0.07
256 0.06
257 0.06
258 0.06
259 0.05
260 0.05
261 0.05
262 0.05
263 0.05
264 0.05
265 0.06
266 0.06
267 0.06
268 0.05
269 0.06
270 0.06
271 0.06
272 0.06
273 0.05
274 0.05
275 0.05
276 0.05
277 0.05
278 0.05
279 0.04
280 0.05
281 0.07
282 0.08
283 0.09
284 0.11
285 0.11
286 0.12
287 0.2
288 0.21
289 0.28
290 0.36
291 0.41
292 0.49
293 0.56
294 0.57
295 0.52
296 0.51
297 0.44
298 0.37
299 0.32
300 0.24
301 0.18
302 0.17
303 0.14
304 0.13
305 0.11
306 0.09
307 0.08
308 0.06
309 0.07
310 0.09
311 0.09
312 0.1
313 0.11
314 0.12
315 0.17
316 0.21
317 0.27
318 0.34
319 0.39
320 0.43
321 0.51
322 0.55
323 0.56
324 0.54
325 0.52
326 0.48
327 0.47
328 0.43
329 0.35
330 0.3
331 0.25
332 0.22
333 0.19
334 0.13
335 0.09
336 0.1
337 0.13
338 0.17
339 0.18
340 0.18
341 0.18
342 0.2
343 0.23
344 0.29
345 0.31
346 0.29
347 0.31
348 0.33
349 0.35
350 0.34
351 0.31
352 0.25
353 0.24
354 0.31
355 0.33
356 0.33
357 0.33
358 0.34
359 0.38
360 0.46
361 0.51
362 0.51
363 0.55
364 0.6
365 0.62
366 0.62
367 0.61
368 0.56
369 0.49
370 0.42
371 0.32
372 0.25
373 0.21
374 0.18
375 0.15
376 0.1
377 0.07
378 0.06
379 0.05
380 0.06
381 0.05
382 0.05
383 0.06
384 0.11
385 0.11
386 0.16
387 0.16
388 0.16
389 0.18
390 0.19
391 0.24
392 0.21
393 0.2
394 0.17
395 0.19
396 0.2
397 0.22
398 0.22
399 0.18
400 0.18
401 0.2
402 0.21
403 0.19
404 0.18
405 0.15
406 0.15
407 0.16
408 0.16
409 0.13
410 0.14
411 0.15
412 0.15
413 0.17
414 0.15
415 0.12
416 0.14
417 0.17
418 0.17
419 0.17
420 0.19
421 0.18
422 0.18
423 0.19
424 0.18
425 0.17
426 0.17
427 0.14
428 0.14
429 0.16
430 0.16
431 0.18
432 0.17
433 0.16