Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CP88

Protein Details
Accession I1CP88   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
33-56KSMIRRISRKTKMQSKNSADRHRLHydrophilic
NLS Segment(s)
PositionSequence
96-112ITRTFKRKGLKSAKKKT
Subcellular Location(s) nucl 17, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MTAKNADKHAQIENMLSHSIPWDVIQKKVGCGKSMIRRISRKTKMQSKNSADRHRLLAPREETKAAIDIRLGLSKSAADASFGVKKPDRSVNPKTITRTFKRKGLKSAKKKTALPLNNDRQKARYDWAKAHKDWSETDWERVVFSDETKIQKRGSNGLEYAWKEDNAPYRDHHYKKKHAYGGGGIML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.22
4 0.17
5 0.15
6 0.14
7 0.12
8 0.11
9 0.17
10 0.18
11 0.2
12 0.27
13 0.27
14 0.3
15 0.37
16 0.38
17 0.31
18 0.33
19 0.38
20 0.42
21 0.49
22 0.52
23 0.52
24 0.58
25 0.64
26 0.71
27 0.72
28 0.71
29 0.72
30 0.76
31 0.78
32 0.8
33 0.83
34 0.8
35 0.82
36 0.83
37 0.82
38 0.75
39 0.68
40 0.63
41 0.59
42 0.55
43 0.47
44 0.46
45 0.41
46 0.41
47 0.41
48 0.38
49 0.32
50 0.28
51 0.3
52 0.22
53 0.18
54 0.14
55 0.12
56 0.13
57 0.14
58 0.13
59 0.09
60 0.09
61 0.09
62 0.09
63 0.09
64 0.08
65 0.06
66 0.07
67 0.09
68 0.14
69 0.15
70 0.18
71 0.18
72 0.19
73 0.21
74 0.28
75 0.3
76 0.32
77 0.38
78 0.44
79 0.47
80 0.5
81 0.51
82 0.51
83 0.53
84 0.5
85 0.54
86 0.48
87 0.5
88 0.55
89 0.54
90 0.57
91 0.62
92 0.68
93 0.69
94 0.77
95 0.78
96 0.76
97 0.74
98 0.7
99 0.69
100 0.64
101 0.61
102 0.6
103 0.62
104 0.63
105 0.64
106 0.58
107 0.5
108 0.47
109 0.42
110 0.37
111 0.34
112 0.32
113 0.37
114 0.46
115 0.5
116 0.49
117 0.52
118 0.5
119 0.45
120 0.42
121 0.37
122 0.37
123 0.32
124 0.34
125 0.31
126 0.28
127 0.26
128 0.25
129 0.26
130 0.17
131 0.16
132 0.18
133 0.19
134 0.26
135 0.29
136 0.32
137 0.3
138 0.33
139 0.35
140 0.37
141 0.38
142 0.37
143 0.33
144 0.33
145 0.38
146 0.36
147 0.38
148 0.33
149 0.29
150 0.25
151 0.28
152 0.34
153 0.3
154 0.31
155 0.29
156 0.35
157 0.45
158 0.5
159 0.56
160 0.57
161 0.65
162 0.73
163 0.8
164 0.79
165 0.73
166 0.72
167 0.67