Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BUW9

Protein Details
Accession I1BUW9    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
12-35RATASDDKKKRGKKDPNAPKRALSBasic
NLS Segment(s)
PositionSequence
16-32SDDKKKRGKKDPNAPKR
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEPSTKVSKRATASDDKKKRGKKDPNAPKRALSAYMFFSQANREKVIKENPEAKFGEIGKILGAKWKEMTEEEKKPFVEKAEADKKRYEDEKAKAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.63
3 0.65
4 0.66
5 0.68
6 0.72
7 0.75
8 0.77
9 0.77
10 0.79
11 0.79
12 0.81
13 0.85
14 0.87
15 0.88
16 0.82
17 0.73
18 0.66
19 0.58
20 0.5
21 0.4
22 0.31
23 0.26
24 0.25
25 0.24
26 0.19
27 0.18
28 0.19
29 0.23
30 0.22
31 0.21
32 0.2
33 0.2
34 0.25
35 0.31
36 0.29
37 0.27
38 0.33
39 0.32
40 0.36
41 0.35
42 0.32
43 0.29
44 0.26
45 0.25
46 0.17
47 0.16
48 0.12
49 0.12
50 0.12
51 0.13
52 0.13
53 0.12
54 0.13
55 0.13
56 0.14
57 0.16
58 0.22
59 0.25
60 0.33
61 0.36
62 0.38
63 0.38
64 0.39
65 0.39
66 0.35
67 0.33
68 0.28
69 0.34
70 0.41
71 0.46
72 0.47
73 0.51
74 0.5
75 0.52
76 0.53
77 0.51
78 0.49
79 0.5