Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BU20

Protein Details
Accession I1BU20   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
27-46SFTLRAKSPGYKRTRRSRTFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014729  Rossmann-like_a/b/a_fold  
IPR006015  Universal_stress_UspA  
IPR006016  UspA  
Pfam View protein in Pfam  
PF00582  Usp  
CDD cd00293  USP_Like  
Amino Acid Sequences MEESSNSGFIRVVSFDTMTNKDLPDYSFTLRAKSPGYKRTRRSRTFMVATDLANYSEYALNWTTDTMMEDGDELIVLRVVTLEMNNKKRDGLLQLEEKESRKKANELMEKIIENSHKSDKKISVVIEFVIGKVQETIQRTISMYQPSLLIVGTRGLSEIRGMFLGSISKYCLQHSPVPVTVVRSEDQIRKSAFDSLNINFSKKKSLAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.2
4 0.23
5 0.23
6 0.23
7 0.22
8 0.21
9 0.21
10 0.21
11 0.21
12 0.22
13 0.23
14 0.29
15 0.28
16 0.31
17 0.3
18 0.31
19 0.3
20 0.35
21 0.4
22 0.42
23 0.51
24 0.57
25 0.65
26 0.74
27 0.8
28 0.78
29 0.78
30 0.77
31 0.76
32 0.73
33 0.66
34 0.61
35 0.52
36 0.46
37 0.41
38 0.33
39 0.25
40 0.19
41 0.17
42 0.12
43 0.11
44 0.11
45 0.11
46 0.11
47 0.11
48 0.11
49 0.11
50 0.1
51 0.09
52 0.1
53 0.08
54 0.07
55 0.06
56 0.06
57 0.06
58 0.05
59 0.05
60 0.04
61 0.03
62 0.04
63 0.04
64 0.03
65 0.03
66 0.04
67 0.04
68 0.05
69 0.11
70 0.17
71 0.22
72 0.24
73 0.24
74 0.25
75 0.25
76 0.26
77 0.23
78 0.21
79 0.2
80 0.25
81 0.26
82 0.28
83 0.29
84 0.29
85 0.29
86 0.26
87 0.24
88 0.21
89 0.21
90 0.23
91 0.3
92 0.36
93 0.35
94 0.37
95 0.36
96 0.34
97 0.33
98 0.31
99 0.23
100 0.17
101 0.17
102 0.22
103 0.23
104 0.24
105 0.28
106 0.28
107 0.3
108 0.31
109 0.3
110 0.24
111 0.21
112 0.2
113 0.18
114 0.16
115 0.13
116 0.11
117 0.1
118 0.08
119 0.08
120 0.09
121 0.1
122 0.13
123 0.15
124 0.15
125 0.16
126 0.17
127 0.18
128 0.21
129 0.2
130 0.18
131 0.16
132 0.15
133 0.14
134 0.14
135 0.12
136 0.08
137 0.06
138 0.07
139 0.07
140 0.06
141 0.07
142 0.07
143 0.07
144 0.08
145 0.08
146 0.08
147 0.08
148 0.08
149 0.07
150 0.08
151 0.1
152 0.09
153 0.09
154 0.11
155 0.15
156 0.16
157 0.18
158 0.21
159 0.23
160 0.29
161 0.33
162 0.36
163 0.34
164 0.36
165 0.35
166 0.35
167 0.32
168 0.29
169 0.25
170 0.23
171 0.26
172 0.29
173 0.31
174 0.33
175 0.32
176 0.32
177 0.33
178 0.38
179 0.34
180 0.32
181 0.35
182 0.31
183 0.38
184 0.37
185 0.38
186 0.33
187 0.33
188 0.37