Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CB22

Protein Details
Accession I1CB22    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
21-42TYQELTTKRRPRKLTHCYKINGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR018608  Gti1/Pac2  
Pfam View protein in Pfam  
PF09729  Gti1_Pac2  
Amino Acid Sequences MQRWTDGRTWSPSRVLGSFLTYQELTTKRRPRKLTHCYKINGLIKQSFSICTASNQKLHLISYYSKADVLSGKLKRPSDDLELNKIEIPKGHYPEINPLGIGGGHTASIYSMRQNSNSPSLTSSSPFSSDEESCYTQDFTFLPTQDVILENLPCSEDYRQLNALRHQLRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.36
3 0.29
4 0.28
5 0.28
6 0.25
7 0.25
8 0.21
9 0.21
10 0.24
11 0.27
12 0.27
13 0.34
14 0.43
15 0.48
16 0.57
17 0.63
18 0.67
19 0.74
20 0.8
21 0.81
22 0.81
23 0.81
24 0.75
25 0.73
26 0.73
27 0.68
28 0.61
29 0.54
30 0.47
31 0.4
32 0.39
33 0.35
34 0.27
35 0.22
36 0.2
37 0.17
38 0.17
39 0.23
40 0.24
41 0.25
42 0.25
43 0.25
44 0.24
45 0.24
46 0.21
47 0.18
48 0.16
49 0.18
50 0.19
51 0.17
52 0.16
53 0.16
54 0.15
55 0.14
56 0.15
57 0.18
58 0.19
59 0.22
60 0.26
61 0.27
62 0.27
63 0.28
64 0.29
65 0.27
66 0.32
67 0.31
68 0.32
69 0.32
70 0.32
71 0.3
72 0.27
73 0.22
74 0.16
75 0.19
76 0.17
77 0.19
78 0.2
79 0.2
80 0.2
81 0.28
82 0.29
83 0.24
84 0.19
85 0.16
86 0.15
87 0.14
88 0.13
89 0.06
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.05
96 0.05
97 0.07
98 0.11
99 0.12
100 0.14
101 0.16
102 0.19
103 0.24
104 0.25
105 0.23
106 0.22
107 0.23
108 0.23
109 0.22
110 0.21
111 0.17
112 0.18
113 0.18
114 0.17
115 0.19
116 0.18
117 0.2
118 0.22
119 0.23
120 0.22
121 0.23
122 0.23
123 0.18
124 0.2
125 0.17
126 0.16
127 0.18
128 0.18
129 0.18
130 0.17
131 0.18
132 0.17
133 0.18
134 0.16
135 0.14
136 0.14
137 0.12
138 0.13
139 0.13
140 0.13
141 0.15
142 0.15
143 0.19
144 0.22
145 0.27
146 0.32
147 0.36
148 0.41
149 0.44
150 0.52