Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BTZ9

Protein Details
Accession I1BTZ9   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
94-114QARLIRQQKLLKKNNNIGKKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 7.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018559  DUF2015  
Pfam View protein in Pfam  
PF09435  DUF2015  
Amino Acid Sequences MLSISVNLAIKVCWFYRQHILHLGSIIADKTNRLIGYHLLPTTEGSFETDIEDGLTSSQFDLTANLDQDDSRAGLKDKEEILKIMKKQKVSFDQARLIRQQKLLKKNNNIGKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.23
3 0.32
4 0.34
5 0.36
6 0.41
7 0.43
8 0.38
9 0.36
10 0.32
11 0.23
12 0.21
13 0.18
14 0.11
15 0.09
16 0.08
17 0.09
18 0.12
19 0.11
20 0.11
21 0.12
22 0.13
23 0.16
24 0.19
25 0.17
26 0.15
27 0.15
28 0.15
29 0.15
30 0.13
31 0.1
32 0.09
33 0.09
34 0.09
35 0.09
36 0.08
37 0.07
38 0.07
39 0.07
40 0.05
41 0.05
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.05
49 0.06
50 0.08
51 0.08
52 0.09
53 0.09
54 0.08
55 0.09
56 0.09
57 0.08
58 0.06
59 0.07
60 0.08
61 0.09
62 0.1
63 0.14
64 0.15
65 0.17
66 0.18
67 0.19
68 0.23
69 0.27
70 0.32
71 0.37
72 0.38
73 0.4
74 0.42
75 0.49
76 0.52
77 0.55
78 0.58
79 0.54
80 0.59
81 0.59
82 0.61
83 0.6
84 0.56
85 0.52
86 0.52
87 0.54
88 0.55
89 0.61
90 0.67
91 0.68
92 0.74
93 0.79
94 0.82