Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BUU9

Protein Details
Accession I1BUU9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
41-61LLDAKIKEDKKKRPSTGQINSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14, cyto_mito 12.999, mito 10.5, cyto_nucl 9.833
Family & Domain DBs
Amino Acid Sequences MAKNSSFGESSKSTGMHAAFGTSAGDFGVVHVVHFKEFSILLDAKIKEDKKKRPSTGQINS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.18
4 0.16
5 0.14
6 0.11
7 0.11
8 0.11
9 0.07
10 0.07
11 0.05
12 0.05
13 0.04
14 0.04
15 0.07
16 0.06
17 0.06
18 0.08
19 0.08
20 0.08
21 0.08
22 0.08
23 0.06
24 0.07
25 0.07
26 0.1
27 0.11
28 0.12
29 0.18
30 0.18
31 0.19
32 0.26
33 0.28
34 0.32
35 0.41
36 0.5
37 0.55
38 0.65
39 0.71
40 0.74
41 0.82