Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BII3

Protein Details
Accession I1BII3    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
66-96EEEKKAKKEKEAKKEKKLKKEKEVMKKPIDVBasic
NLS Segment(s)
PositionSequence
69-92KKAKKEKEAKKEKKLKKEKEVMKK
Subcellular Location(s) E.R. 11, nucl 4, cyto 3, extr 3, golg 3, mito 1, plas 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MRLLLLLIVVVIHSICLVIAEKETDLKKLKELENETLRQIAVKEVEAMKKLFEKEQQVYVSMLKVEEEKKAKKEKEAKKEKKLKKEKEVMKKPIDVDEDQGEDDDDEEVKENR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.04
4 0.05
5 0.06
6 0.07
7 0.08
8 0.08
9 0.13
10 0.14
11 0.18
12 0.21
13 0.22
14 0.25
15 0.3
16 0.33
17 0.36
18 0.4
19 0.44
20 0.46
21 0.46
22 0.44
23 0.38
24 0.35
25 0.28
26 0.23
27 0.17
28 0.11
29 0.1
30 0.11
31 0.12
32 0.14
33 0.15
34 0.15
35 0.14
36 0.16
37 0.16
38 0.16
39 0.18
40 0.21
41 0.21
42 0.25
43 0.25
44 0.23
45 0.23
46 0.22
47 0.19
48 0.14
49 0.12
50 0.08
51 0.09
52 0.09
53 0.13
54 0.18
55 0.21
56 0.27
57 0.36
58 0.37
59 0.44
60 0.53
61 0.58
62 0.63
63 0.72
64 0.76
65 0.78
66 0.87
67 0.87
68 0.88
69 0.89
70 0.88
71 0.87
72 0.87
73 0.86
74 0.87
75 0.89
76 0.87
77 0.82
78 0.77
79 0.68
80 0.64
81 0.59
82 0.49
83 0.42
84 0.37
85 0.33
86 0.28
87 0.27
88 0.21
89 0.16
90 0.15
91 0.12
92 0.09
93 0.08