Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1CA94

Protein Details
Accession I1CA94    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
47-70WYQIEKRTNMPWRKERDKNWDQETHydrophilic
439-464KFKTTTPTKLTKKTTVRKSVKSAAISHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011257  DNA_glycosylase  
IPR003651  Endonuclease3_FeS-loop_motif  
IPR003265  HhH-GPD_domain  
IPR023170  HhH_base_excis_C  
IPR000445  HhH_motif  
IPR044298  MIG/MutY  
IPR029119  MutY_C  
IPR015797  NUDIX_hydrolase-like_dom_sf  
Gene Ontology GO:0051539  F:4 iron, 4 sulfur cluster binding  
GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
GO:0000702  F:oxidized base lesion DNA N-glycosylase activity  
GO:0000701  F:purine-specific mismatch base pair DNA N-glycosylase activity  
GO:0006285  P:base-excision repair, AP site formation  
Pfam View protein in Pfam  
PF00633  HHH  
PF00730  HhH-GPD  
PF14815  NUDIX_4  
CDD cd03431  DNA_Glycosylase_C  
cd00056  ENDO3c  
Amino Acid Sequences MTAKVDRGHSSSKIEECIKSKRLHHLNDYHTVSAEEKLEIQHDLLRWYQIEKRTNMPWRKERDKNWDQETLAQRAYEATVIDYYNRWMTAFPTIHSLAKADLEKVNTLWAGLGYYSRAKRLWEGAKKIVSEFDGRLPNNAQELQREVPGVGRYTAGAVASIVFGEATPVVDGNVIRVLSRWRAIHADPKKAKTVELFWEIAASIVPESNPGDFNQAMMELGARVCVPQNPNCNQCPISNNCHAFNQLQLYKSLSKNGFFNEKKRKQMESEHECEICDEIQSDLNEDAYAVTRYPLKVEKKPPRDEECAVSIVERIRSNGNDPLYLISKRPETGLLAGLWEFPSVELTSPNTNYSARSLETTNYLKMKYSIELKEPTRHDLGNVVHLFSHIRKVYHVEWVQYESNDEPMESEEIKWVTMSELQKAPIPTGLKKALKLFEKFKTTTPTKLTKKTTVRKSVKSAAISSFFTVKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.45
3 0.45
4 0.51
5 0.52
6 0.52
7 0.54
8 0.59
9 0.63
10 0.65
11 0.69
12 0.7
13 0.69
14 0.72
15 0.72
16 0.62
17 0.53
18 0.47
19 0.39
20 0.33
21 0.28
22 0.19
23 0.16
24 0.16
25 0.17
26 0.16
27 0.16
28 0.17
29 0.17
30 0.19
31 0.19
32 0.2
33 0.2
34 0.22
35 0.27
36 0.32
37 0.38
38 0.38
39 0.42
40 0.48
41 0.58
42 0.63
43 0.67
44 0.67
45 0.7
46 0.77
47 0.8
48 0.8
49 0.81
50 0.81
51 0.81
52 0.78
53 0.75
54 0.67
55 0.66
56 0.63
57 0.57
58 0.49
59 0.4
60 0.34
61 0.27
62 0.27
63 0.2
64 0.14
65 0.11
66 0.11
67 0.12
68 0.13
69 0.12
70 0.14
71 0.15
72 0.14
73 0.13
74 0.12
75 0.13
76 0.21
77 0.21
78 0.2
79 0.24
80 0.25
81 0.26
82 0.26
83 0.25
84 0.17
85 0.2
86 0.21
87 0.17
88 0.18
89 0.19
90 0.2
91 0.19
92 0.2
93 0.16
94 0.15
95 0.12
96 0.1
97 0.08
98 0.07
99 0.08
100 0.08
101 0.14
102 0.15
103 0.17
104 0.18
105 0.19
106 0.22
107 0.29
108 0.37
109 0.4
110 0.45
111 0.49
112 0.52
113 0.52
114 0.49
115 0.43
116 0.35
117 0.3
118 0.25
119 0.24
120 0.27
121 0.27
122 0.28
123 0.28
124 0.27
125 0.27
126 0.29
127 0.24
128 0.19
129 0.23
130 0.22
131 0.21
132 0.2
133 0.17
134 0.17
135 0.18
136 0.17
137 0.14
138 0.12
139 0.11
140 0.12
141 0.12
142 0.09
143 0.07
144 0.06
145 0.06
146 0.05
147 0.05
148 0.04
149 0.03
150 0.03
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.05
158 0.05
159 0.06
160 0.08
161 0.07
162 0.07
163 0.08
164 0.1
165 0.12
166 0.15
167 0.15
168 0.15
169 0.18
170 0.19
171 0.28
172 0.32
173 0.4
174 0.41
175 0.44
176 0.48
177 0.45
178 0.44
179 0.37
180 0.35
181 0.3
182 0.29
183 0.27
184 0.21
185 0.21
186 0.2
187 0.18
188 0.14
189 0.09
190 0.04
191 0.04
192 0.04
193 0.05
194 0.05
195 0.06
196 0.07
197 0.07
198 0.1
199 0.1
200 0.1
201 0.09
202 0.09
203 0.08
204 0.07
205 0.07
206 0.04
207 0.04
208 0.04
209 0.04
210 0.04
211 0.04
212 0.07
213 0.1
214 0.14
215 0.21
216 0.25
217 0.29
218 0.29
219 0.32
220 0.31
221 0.3
222 0.3
223 0.27
224 0.29
225 0.32
226 0.33
227 0.32
228 0.31
229 0.31
230 0.27
231 0.24
232 0.23
233 0.19
234 0.17
235 0.17
236 0.19
237 0.21
238 0.21
239 0.26
240 0.22
241 0.21
242 0.22
243 0.23
244 0.3
245 0.28
246 0.36
247 0.42
248 0.47
249 0.53
250 0.56
251 0.56
252 0.51
253 0.58
254 0.6
255 0.56
256 0.54
257 0.5
258 0.46
259 0.43
260 0.4
261 0.31
262 0.21
263 0.13
264 0.1
265 0.07
266 0.09
267 0.09
268 0.11
269 0.1
270 0.1
271 0.09
272 0.09
273 0.08
274 0.07
275 0.07
276 0.06
277 0.06
278 0.08
279 0.09
280 0.11
281 0.18
282 0.22
283 0.29
284 0.4
285 0.49
286 0.57
287 0.65
288 0.7
289 0.7
290 0.71
291 0.66
292 0.59
293 0.51
294 0.44
295 0.36
296 0.28
297 0.23
298 0.19
299 0.2
300 0.17
301 0.15
302 0.16
303 0.17
304 0.2
305 0.23
306 0.22
307 0.19
308 0.19
309 0.21
310 0.21
311 0.21
312 0.19
313 0.17
314 0.18
315 0.18
316 0.18
317 0.17
318 0.15
319 0.16
320 0.17
321 0.15
322 0.14
323 0.14
324 0.13
325 0.12
326 0.1
327 0.08
328 0.06
329 0.08
330 0.07
331 0.08
332 0.08
333 0.11
334 0.15
335 0.16
336 0.17
337 0.17
338 0.17
339 0.18
340 0.19
341 0.19
342 0.16
343 0.17
344 0.18
345 0.17
346 0.23
347 0.24
348 0.26
349 0.26
350 0.26
351 0.24
352 0.25
353 0.26
354 0.23
355 0.28
356 0.27
357 0.3
358 0.36
359 0.38
360 0.45
361 0.45
362 0.46
363 0.42
364 0.39
365 0.34
366 0.34
367 0.32
368 0.33
369 0.31
370 0.27
371 0.24
372 0.24
373 0.26
374 0.21
375 0.27
376 0.21
377 0.2
378 0.21
379 0.27
380 0.28
381 0.36
382 0.37
383 0.32
384 0.32
385 0.36
386 0.37
387 0.32
388 0.33
389 0.23
390 0.24
391 0.21
392 0.19
393 0.14
394 0.14
395 0.17
396 0.16
397 0.16
398 0.17
399 0.17
400 0.17
401 0.17
402 0.15
403 0.13
404 0.19
405 0.2
406 0.21
407 0.23
408 0.24
409 0.29
410 0.29
411 0.28
412 0.27
413 0.29
414 0.27
415 0.31
416 0.39
417 0.39
418 0.41
419 0.47
420 0.49
421 0.52
422 0.56
423 0.55
424 0.54
425 0.59
426 0.57
427 0.56
428 0.59
429 0.55
430 0.57
431 0.58
432 0.6
433 0.61
434 0.68
435 0.7
436 0.71
437 0.78
438 0.8
439 0.83
440 0.83
441 0.84
442 0.83
443 0.84
444 0.83
445 0.8
446 0.75
447 0.68
448 0.63
449 0.58
450 0.52
451 0.46