Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BKN1

Protein Details
Accession I1BKN1   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
38-58ITVGVKKPKPAKKRKSDGYISHydrophilic
NLS Segment(s)
PositionSequence
43-52KKPKPAKKRK
Subcellular Location(s) mito 15, nucl 3, cyto 3, plas 3, cyto_nucl 3, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
IPR038717  Tc1-like_DDE_dom  
Gene Ontology GO:0016020  C:membrane  
GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF13358  DDE_3  
Amino Acid Sequences MKRSRAWSNKGTRAIVTRPTTRANTVSILGAISASGLITVGVKKPKPAKKRKSDGYISSGTVTGHHIIFLKTTLDEMDKHPHMKGHYIVMDNAPIHTHENIKYIEYRGYKCVYPSTYSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.54
3 0.5
4 0.46
5 0.43
6 0.46
7 0.46
8 0.44
9 0.41
10 0.35
11 0.31
12 0.27
13 0.24
14 0.19
15 0.16
16 0.13
17 0.1
18 0.08
19 0.05
20 0.04
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.04
27 0.07
28 0.12
29 0.13
30 0.17
31 0.26
32 0.35
33 0.45
34 0.55
35 0.62
36 0.69
37 0.78
38 0.82
39 0.81
40 0.79
41 0.73
42 0.67
43 0.59
44 0.49
45 0.4
46 0.33
47 0.24
48 0.18
49 0.15
50 0.11
51 0.09
52 0.08
53 0.08
54 0.08
55 0.08
56 0.08
57 0.08
58 0.07
59 0.07
60 0.07
61 0.08
62 0.09
63 0.11
64 0.18
65 0.19
66 0.21
67 0.21
68 0.23
69 0.23
70 0.26
71 0.25
72 0.23
73 0.25
74 0.25
75 0.25
76 0.24
77 0.26
78 0.21
79 0.2
80 0.16
81 0.13
82 0.14
83 0.15
84 0.17
85 0.16
86 0.2
87 0.21
88 0.22
89 0.24
90 0.23
91 0.29
92 0.3
93 0.32
94 0.32
95 0.35
96 0.34
97 0.34
98 0.39
99 0.35