Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CQV9

Protein Details
Accession I1CQV9   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
70-99LDEKKLKQKSTKPSNRQYHRKQNREAIKASHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MFNSFVRSPVLICTSRLHTTRILFNTAVNARIASSAPKGTTLKGIQFLKDGKDPVALDDSEYPDWLWDLLDEKKLKQKSTKPSNRQYHRKQNREAIKASNFMKDKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.33
3 0.34
4 0.32
5 0.31
6 0.33
7 0.38
8 0.37
9 0.36
10 0.3
11 0.29
12 0.34
13 0.3
14 0.28
15 0.21
16 0.18
17 0.15
18 0.15
19 0.15
20 0.1
21 0.11
22 0.12
23 0.12
24 0.15
25 0.16
26 0.15
27 0.2
28 0.19
29 0.19
30 0.24
31 0.25
32 0.21
33 0.24
34 0.24
35 0.21
36 0.22
37 0.21
38 0.15
39 0.17
40 0.16
41 0.15
42 0.16
43 0.13
44 0.12
45 0.13
46 0.15
47 0.12
48 0.13
49 0.11
50 0.09
51 0.09
52 0.08
53 0.07
54 0.04
55 0.07
56 0.09
57 0.14
58 0.15
59 0.17
60 0.25
61 0.28
62 0.31
63 0.36
64 0.43
65 0.48
66 0.59
67 0.68
68 0.7
69 0.78
70 0.85
71 0.87
72 0.9
73 0.9
74 0.9
75 0.9
76 0.89
77 0.87
78 0.86
79 0.86
80 0.82
81 0.75
82 0.71
83 0.65
84 0.63
85 0.57
86 0.56
87 0.49