Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CHL8

Protein Details
Accession I1CHL8   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-48KLYAWKQPNEKLKRRHVKQTVKHGGGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 11.666, mito_nucl 8.833, cyto 7, cyto_pero 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
IPR038717  Tc1-like_DDE_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF13358  DDE_3  
Amino Acid Sequences MEDWKRVIWSDETKVNRFGSEGKLYAWKQPNEKLKRRHVKQTVKHGGGSLMVWSCISWYGVGYIVDVGKNMDKSVYLSVLQDDLVKSMTGYCEENDLIMADFEFMQDNDPKHKSKIVSEWLSKQDFTAMECPPQSPDLNPIENMWNTLKNACLNSMIVLLPLWMNYGLVRSRLGTKLPRKNVKIILKLCLNDVLTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.46
3 0.4
4 0.35
5 0.33
6 0.32
7 0.31
8 0.29
9 0.26
10 0.33
11 0.34
12 0.41
13 0.46
14 0.44
15 0.44
16 0.51
17 0.6
18 0.62
19 0.7
20 0.7
21 0.73
22 0.8
23 0.8
24 0.83
25 0.83
26 0.84
27 0.83
28 0.85
29 0.85
30 0.76
31 0.71
32 0.61
33 0.51
34 0.41
35 0.33
36 0.23
37 0.13
38 0.11
39 0.1
40 0.09
41 0.08
42 0.08
43 0.08
44 0.06
45 0.05
46 0.06
47 0.08
48 0.08
49 0.08
50 0.08
51 0.08
52 0.08
53 0.08
54 0.08
55 0.08
56 0.08
57 0.08
58 0.07
59 0.07
60 0.09
61 0.1
62 0.1
63 0.09
64 0.09
65 0.1
66 0.1
67 0.1
68 0.09
69 0.08
70 0.07
71 0.07
72 0.07
73 0.06
74 0.06
75 0.06
76 0.07
77 0.07
78 0.07
79 0.08
80 0.08
81 0.08
82 0.08
83 0.08
84 0.06
85 0.05
86 0.05
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.06
93 0.08
94 0.09
95 0.13
96 0.17
97 0.18
98 0.19
99 0.23
100 0.22
101 0.23
102 0.3
103 0.33
104 0.37
105 0.38
106 0.42
107 0.43
108 0.43
109 0.4
110 0.33
111 0.27
112 0.22
113 0.21
114 0.21
115 0.16
116 0.17
117 0.18
118 0.18
119 0.17
120 0.19
121 0.17
122 0.13
123 0.19
124 0.21
125 0.22
126 0.22
127 0.22
128 0.24
129 0.23
130 0.25
131 0.21
132 0.19
133 0.19
134 0.19
135 0.2
136 0.18
137 0.19
138 0.18
139 0.17
140 0.15
141 0.15
142 0.16
143 0.13
144 0.11
145 0.1
146 0.09
147 0.07
148 0.07
149 0.07
150 0.06
151 0.06
152 0.06
153 0.09
154 0.1
155 0.12
156 0.13
157 0.13
158 0.18
159 0.2
160 0.25
161 0.31
162 0.4
163 0.49
164 0.59
165 0.67
166 0.67
167 0.73
168 0.77
169 0.77
170 0.77
171 0.7
172 0.67
173 0.63
174 0.6
175 0.54
176 0.5