Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BX62

Protein Details
Accession I1BX62    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
41-70DLTLRKPKIVQKKNAFNKREERKRDNNGALHydrophilic
NLS Segment(s)
PositionSequence
52-55KKNA
57-60NKRE
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 5, cyto 1.5
Family & Domain DBs
Amino Acid Sequences MHLRQKFGRSRQGVSAKTVSLSNRGIPITVIEAICGLGIIDLTLRKPKIVQKKNAFNKREERKRDNNGALDVAERSDGFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.53
3 0.43
4 0.39
5 0.38
6 0.29
7 0.25
8 0.25
9 0.21
10 0.2
11 0.2
12 0.19
13 0.16
14 0.16
15 0.13
16 0.14
17 0.12
18 0.09
19 0.09
20 0.09
21 0.08
22 0.07
23 0.05
24 0.02
25 0.02
26 0.02
27 0.03
28 0.03
29 0.04
30 0.08
31 0.08
32 0.08
33 0.11
34 0.18
35 0.29
36 0.37
37 0.47
38 0.53
39 0.64
40 0.74
41 0.82
42 0.78
43 0.73
44 0.75
45 0.76
46 0.77
47 0.75
48 0.73
49 0.74
50 0.8
51 0.83
52 0.8
53 0.74
54 0.66
55 0.59
56 0.5
57 0.42
58 0.33
59 0.24
60 0.18