Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1CGS9

Protein Details
Accession I1CGS9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
31-56SLPVKHRWMKLPRRKPKKSLFNRFVPHydrophilic
NLS Segment(s)
PositionSequence
32-48LPVKHRWMKLPRRKPKK
Subcellular Location(s) extr 9, plas 5, mito 4, golg 4, E.R. 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MINFKAYRAILLLVILSLDCALSDELLPRRSLPVKHRWMKLPRRKPKKSLFNRFVPDFADPHRCEPKQLAGPGARAHD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.05
4 0.04
5 0.04
6 0.03
7 0.04
8 0.04
9 0.05
10 0.05
11 0.09
12 0.12
13 0.14
14 0.14
15 0.14
16 0.17
17 0.2
18 0.24
19 0.27
20 0.33
21 0.42
22 0.49
23 0.52
24 0.56
25 0.62
26 0.69
27 0.73
28 0.74
29 0.75
30 0.79
31 0.82
32 0.83
33 0.84
34 0.84
35 0.85
36 0.85
37 0.82
38 0.8
39 0.8
40 0.72
41 0.63
42 0.54
43 0.45
44 0.36
45 0.32
46 0.33
47 0.28
48 0.33
49 0.4
50 0.39
51 0.4
52 0.42
53 0.47
54 0.45
55 0.46
56 0.46
57 0.41
58 0.44