Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CKT2

Protein Details
Accession I1CKT2   
Localization Confidence High
Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
47-75MTEKYHYKDKERKKRTRKTKMREEEDVKRBasic
NLS Segment(s)
PositionSequence
55-71DKERKKRTRKTKMREEE
74-75KR
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR020956  TF_Aft1_OSM  
Pfam View protein in Pfam  
PF11785  Aft1_OSA  
Amino Acid Sequences MNQLNKRTEQETVLPPTYAKLPTIKLEEEPNPFEESFEANIVGYSVMTEKYHYKDKERKKRTRKTKMREEEDVKRKNFLERNRIAHKDCLVNQQEIHRALNQPIPFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.33
3 0.32
4 0.32
5 0.27
6 0.22
7 0.18
8 0.19
9 0.23
10 0.27
11 0.26
12 0.25
13 0.29
14 0.32
15 0.33
16 0.33
17 0.31
18 0.3
19 0.28
20 0.27
21 0.22
22 0.19
23 0.16
24 0.14
25 0.12
26 0.09
27 0.09
28 0.09
29 0.08
30 0.05
31 0.04
32 0.04
33 0.05
34 0.05
35 0.06
36 0.08
37 0.11
38 0.19
39 0.2
40 0.27
41 0.35
42 0.46
43 0.56
44 0.64
45 0.72
46 0.75
47 0.85
48 0.89
49 0.91
50 0.91
51 0.9
52 0.91
53 0.91
54 0.86
55 0.85
56 0.8
57 0.79
58 0.79
59 0.77
60 0.66
61 0.6
62 0.54
63 0.53
64 0.52
65 0.5
66 0.5
67 0.5
68 0.57
69 0.61
70 0.65
71 0.61
72 0.59
73 0.55
74 0.52
75 0.48
76 0.5
77 0.46
78 0.43
79 0.42
80 0.42
81 0.45
82 0.4
83 0.39
84 0.33
85 0.33
86 0.33
87 0.38