Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BS90

Protein Details
Accession I1BS90    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
43-64HLDCKPPEKTKRKLHDEKQSLHBasic
NLS Segment(s)
PositionSequence
54-54R
69-69K
Subcellular Location(s) nucl 17.5, cyto_nucl 13.333, cyto 8, cyto_pero 4.833
Family & Domain DBs
Amino Acid Sequences MSVRFIYENGKGEVVDESGNEHFNMDIDTEAYPIDYITNFDEHLDCKPPEKTKRKLHDEKQSLHEKPNKKTKMKFAHIGNMVMMSKNNYFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.14
3 0.1
4 0.12
5 0.12
6 0.13
7 0.12
8 0.11
9 0.1
10 0.1
11 0.1
12 0.07
13 0.06
14 0.06
15 0.06
16 0.06
17 0.06
18 0.06
19 0.05
20 0.05
21 0.05
22 0.04
23 0.05
24 0.06
25 0.07
26 0.07
27 0.08
28 0.08
29 0.09
30 0.1
31 0.13
32 0.12
33 0.14
34 0.17
35 0.24
36 0.33
37 0.41
38 0.49
39 0.55
40 0.64
41 0.73
42 0.79
43 0.8
44 0.81
45 0.8
46 0.76
47 0.73
48 0.73
49 0.64
50 0.62
51 0.61
52 0.57
53 0.58
54 0.64
55 0.65
56 0.64
57 0.69
58 0.72
59 0.75
60 0.75
61 0.75
62 0.69
63 0.7
64 0.66
65 0.6
66 0.5
67 0.43
68 0.36
69 0.3
70 0.25
71 0.2