Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1CEE8

Protein Details
Accession I1CEE8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
45-67WNRLDAKIKEDKKKRPSTGQINSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto_mito 11.833, cyto 9.5, mito_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MAKNSSFGESSKSTGMHAAFGTSAGDFGVVHVVHFKEFNIFFVSWNRLDAKIKEDKKKRPSTGQINS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.18
4 0.16
5 0.14
6 0.12
7 0.12
8 0.11
9 0.07
10 0.07
11 0.05
12 0.05
13 0.04
14 0.04
15 0.07
16 0.06
17 0.06
18 0.08
19 0.08
20 0.08
21 0.09
22 0.09
23 0.09
24 0.09
25 0.11
26 0.13
27 0.13
28 0.14
29 0.17
30 0.21
31 0.18
32 0.2
33 0.2
34 0.19
35 0.22
36 0.23
37 0.25
38 0.31
39 0.39
40 0.47
41 0.54
42 0.62
43 0.69
44 0.79
45 0.8
46 0.81
47 0.83