Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1C916

Protein Details
Accession I1C916    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
36-55AARHRKSRLRWAKKHIHWTKBasic
NLS Segment(s)
PositionSequence
38-49RHRKSRLRWAKK
Subcellular Location(s) nucl 12.5, cyto_nucl 12, cyto 10.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MDSTKLDAFVCIETLRSTYDRLAFKSYRATHKLTLAARHRKSRLRWAKKHIHWTKDQWKNVAWSDEPRFYHGTYINILANRFHPWFTNGTMHQKRDFTFQEDGASCYTGGYARW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.14
4 0.15
5 0.16
6 0.23
7 0.25
8 0.27
9 0.33
10 0.3
11 0.31
12 0.38
13 0.41
14 0.43
15 0.44
16 0.46
17 0.42
18 0.44
19 0.49
20 0.42
21 0.45
22 0.46
23 0.52
24 0.52
25 0.57
26 0.59
27 0.59
28 0.61
29 0.64
30 0.66
31 0.66
32 0.7
33 0.71
34 0.77
35 0.76
36 0.83
37 0.79
38 0.72
39 0.66
40 0.67
41 0.68
42 0.66
43 0.62
44 0.53
45 0.48
46 0.46
47 0.43
48 0.37
49 0.28
50 0.24
51 0.26
52 0.29
53 0.28
54 0.28
55 0.28
56 0.25
57 0.28
58 0.24
59 0.22
60 0.18
61 0.2
62 0.19
63 0.18
64 0.18
65 0.16
66 0.15
67 0.17
68 0.17
69 0.16
70 0.15
71 0.16
72 0.18
73 0.2
74 0.25
75 0.25
76 0.35
77 0.41
78 0.43
79 0.45
80 0.45
81 0.43
82 0.45
83 0.44
84 0.39
85 0.37
86 0.34
87 0.37
88 0.34
89 0.35
90 0.29
91 0.27
92 0.21
93 0.17
94 0.17