Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BI08

Protein Details
Accession I1BI08    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
28-49SDWTTKTREKIKEQTNRLEEKRHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, mito 4, E.R. 3, pero 2, golg 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021261  GPCAT  
Gene Ontology GO:0016020  C:membrane  
GO:0016746  F:acyltransferase activity  
GO:0006629  P:lipid metabolic process  
Pfam View protein in Pfam  
PF10998  DUF2838  
Amino Acid Sequences MIDRLSTALDQVTRQLEEKQKEFVARSSDWTTKTREKIKEQTNRLEEKRTRIQGLLVGQYHKIDRRMNRDAKTVQLRDKISFVVGVGNSCVIPALAIRYPHSIPAYYSIQLMVLLILRYAIYRSRRWHYFIFDMCYFVNVMTILFLWIKPDSSLLLIASFCMTNGPVAWAIITWRNSLVFHSLDKVTSVFIHILPPLVMYCLRWMPELVKDVYCDNQLIVTQYRDTRYPAFKEVSSIDIKQVMIYSTAAYALWQTLYYLFIMVGRRDKVESGIRLTSYSWLLNDPHGKKGFIQRSAFLFGEKYKLEMFMLLQLIYNVITSLPTFYLYQHFWLHTAFLICMYAVSVWNGANYYIEVFSRRYINELDKIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.29
3 0.34
4 0.4
5 0.41
6 0.42
7 0.42
8 0.45
9 0.46
10 0.43
11 0.41
12 0.36
13 0.4
14 0.41
15 0.42
16 0.41
17 0.42
18 0.45
19 0.47
20 0.54
21 0.57
22 0.59
23 0.63
24 0.69
25 0.76
26 0.79
27 0.78
28 0.8
29 0.79
30 0.8
31 0.75
32 0.75
33 0.69
34 0.67
35 0.69
36 0.65
37 0.59
38 0.51
39 0.5
40 0.44
41 0.44
42 0.43
43 0.35
44 0.31
45 0.29
46 0.3
47 0.31
48 0.31
49 0.31
50 0.32
51 0.36
52 0.43
53 0.53
54 0.59
55 0.59
56 0.63
57 0.59
58 0.61
59 0.64
60 0.6
61 0.57
62 0.56
63 0.55
64 0.49
65 0.49
66 0.41
67 0.32
68 0.27
69 0.2
70 0.17
71 0.15
72 0.14
73 0.13
74 0.12
75 0.11
76 0.11
77 0.1
78 0.05
79 0.05
80 0.05
81 0.08
82 0.09
83 0.11
84 0.13
85 0.17
86 0.17
87 0.2
88 0.22
89 0.19
90 0.17
91 0.21
92 0.23
93 0.19
94 0.19
95 0.16
96 0.15
97 0.14
98 0.13
99 0.08
100 0.06
101 0.06
102 0.05
103 0.05
104 0.05
105 0.05
106 0.06
107 0.11
108 0.14
109 0.19
110 0.24
111 0.31
112 0.34
113 0.39
114 0.41
115 0.41
116 0.44
117 0.42
118 0.43
119 0.37
120 0.35
121 0.3
122 0.28
123 0.23
124 0.16
125 0.13
126 0.07
127 0.07
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.07
134 0.07
135 0.07
136 0.07
137 0.07
138 0.07
139 0.07
140 0.08
141 0.06
142 0.07
143 0.07
144 0.07
145 0.07
146 0.06
147 0.05
148 0.05
149 0.05
150 0.04
151 0.04
152 0.05
153 0.05
154 0.05
155 0.05
156 0.05
157 0.06
158 0.09
159 0.1
160 0.1
161 0.1
162 0.11
163 0.11
164 0.12
165 0.13
166 0.1
167 0.1
168 0.12
169 0.12
170 0.11
171 0.12
172 0.11
173 0.09
174 0.08
175 0.08
176 0.07
177 0.07
178 0.08
179 0.07
180 0.08
181 0.07
182 0.07
183 0.06
184 0.06
185 0.06
186 0.05
187 0.07
188 0.08
189 0.09
190 0.09
191 0.09
192 0.1
193 0.13
194 0.16
195 0.16
196 0.15
197 0.16
198 0.16
199 0.17
200 0.17
201 0.13
202 0.1
203 0.09
204 0.09
205 0.1
206 0.11
207 0.1
208 0.12
209 0.14
210 0.15
211 0.16
212 0.18
213 0.21
214 0.24
215 0.26
216 0.29
217 0.29
218 0.28
219 0.29
220 0.28
221 0.27
222 0.25
223 0.22
224 0.19
225 0.18
226 0.18
227 0.16
228 0.15
229 0.12
230 0.1
231 0.1
232 0.09
233 0.07
234 0.07
235 0.07
236 0.06
237 0.06
238 0.05
239 0.05
240 0.05
241 0.05
242 0.05
243 0.06
244 0.06
245 0.06
246 0.06
247 0.08
248 0.1
249 0.12
250 0.16
251 0.16
252 0.18
253 0.18
254 0.19
255 0.21
256 0.25
257 0.26
258 0.26
259 0.27
260 0.27
261 0.27
262 0.27
263 0.25
264 0.2
265 0.18
266 0.14
267 0.14
268 0.15
269 0.19
270 0.27
271 0.27
272 0.33
273 0.34
274 0.34
275 0.35
276 0.44
277 0.47
278 0.46
279 0.46
280 0.42
281 0.44
282 0.48
283 0.45
284 0.35
285 0.3
286 0.23
287 0.26
288 0.23
289 0.21
290 0.17
291 0.18
292 0.17
293 0.16
294 0.16
295 0.15
296 0.16
297 0.14
298 0.14
299 0.13
300 0.13
301 0.12
302 0.11
303 0.06
304 0.05
305 0.06
306 0.06
307 0.08
308 0.08
309 0.09
310 0.1
311 0.11
312 0.16
313 0.17
314 0.21
315 0.22
316 0.23
317 0.22
318 0.22
319 0.22
320 0.19
321 0.19
322 0.16
323 0.13
324 0.13
325 0.11
326 0.11
327 0.1
328 0.09
329 0.08
330 0.09
331 0.1
332 0.1
333 0.11
334 0.11
335 0.11
336 0.11
337 0.11
338 0.11
339 0.11
340 0.12
341 0.14
342 0.15
343 0.18
344 0.22
345 0.21
346 0.23
347 0.26
348 0.32