Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1C6Z8

Protein Details
Accession I1C6Z8    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAKSKNHTNHNQNKKAHRNGIKKHydrophilic
NLS Segment(s)
PositionSequence
14-60KKAHRNGIKKAATHKYRSQKGLDAKFLRNQRFAKKGTQKALAAAVKK
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKKAATHKYRSQKGLDAKFLRNQRFAKKGTQKALAAAVKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.81
5 0.79
6 0.77
7 0.8
8 0.74
9 0.66
10 0.65
11 0.65
12 0.6
13 0.57
14 0.57
15 0.57
16 0.58
17 0.59
18 0.53
19 0.5
20 0.53
21 0.53
22 0.54
23 0.49
24 0.46
25 0.49
26 0.54
27 0.51
28 0.5
29 0.5
30 0.49
31 0.51
32 0.51
33 0.56
34 0.59
35 0.63
36 0.62
37 0.65
38 0.59
39 0.54
40 0.6