Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3RIX3

Protein Details
Accession E3RIX3   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20NNLRIKRPKKNVQIDYLRKSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
KEGG pte:PTT_08027  -  
Amino Acid Sequences NNLRIKRPKKNVQIDYLRKSARNATIRKHIYDAVKLDTSAETTQRIIPEDRELLESG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.78
3 0.75
4 0.66
5 0.57
6 0.52
7 0.48
8 0.45
9 0.45
10 0.42
11 0.4
12 0.48
13 0.49
14 0.48
15 0.44
16 0.4
17 0.34
18 0.34
19 0.31
20 0.25
21 0.23
22 0.22
23 0.21
24 0.17
25 0.18
26 0.16
27 0.15
28 0.12
29 0.13
30 0.16
31 0.16
32 0.19
33 0.18
34 0.19
35 0.24
36 0.25
37 0.25