Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3REX3

Protein Details
Accession E3REX3    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
78-110GEGDVMKKKSQKKKSQKKKKKANKLMREKEVRVBasic
NLS Segment(s)
PositionSequence
84-104KKKSQKKKSQKKKKKANKLMR
Subcellular Location(s) nucl 19, cyto_nucl 11, mito 7
Family & Domain DBs
KEGG pte:PTT_05275  -  
Amino Acid Sequences MTRERFCKLHPSQDGVCGCPNFWKKKQSKHTAESMTPSVPRGSVCTPTVTKDGDSEESVLRARNQKKEEETMPSRISGEGDVMKKKSQKKKSQKKKKKANKLMREKEVRVLIDYELPSGSDRLSWDTDEVRRMVGEIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.47
3 0.47
4 0.37
5 0.33
6 0.35
7 0.4
8 0.4
9 0.44
10 0.52
11 0.54
12 0.64
13 0.74
14 0.76
15 0.78
16 0.75
17 0.79
18 0.74
19 0.7
20 0.64
21 0.56
22 0.47
23 0.38
24 0.34
25 0.25
26 0.2
27 0.17
28 0.17
29 0.16
30 0.18
31 0.18
32 0.21
33 0.21
34 0.23
35 0.25
36 0.22
37 0.2
38 0.18
39 0.19
40 0.17
41 0.17
42 0.16
43 0.14
44 0.14
45 0.14
46 0.13
47 0.13
48 0.19
49 0.23
50 0.28
51 0.3
52 0.33
53 0.36
54 0.39
55 0.39
56 0.38
57 0.37
58 0.35
59 0.33
60 0.3
61 0.27
62 0.23
63 0.22
64 0.14
65 0.13
66 0.12
67 0.14
68 0.16
69 0.17
70 0.2
71 0.25
72 0.33
73 0.41
74 0.48
75 0.56
76 0.65
77 0.75
78 0.84
79 0.9
80 0.93
81 0.94
82 0.95
83 0.95
84 0.95
85 0.95
86 0.95
87 0.94
88 0.94
89 0.93
90 0.91
91 0.88
92 0.79
93 0.74
94 0.68
95 0.58
96 0.49
97 0.41
98 0.32
99 0.29
100 0.27
101 0.22
102 0.16
103 0.16
104 0.15
105 0.14
106 0.13
107 0.1
108 0.11
109 0.14
110 0.16
111 0.17
112 0.18
113 0.23
114 0.26
115 0.28
116 0.27
117 0.24
118 0.22