Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BIH9

Protein Details
Accession I1BIH9   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
73-107GLAEPPKGGRKQRKEKKNREKKFRGVKKTKKVRKEBasic
NLS Segment(s)
PositionSequence
77-107PPKGGRKQRKEKKNREKKFRGVKKTKKVRKE
Subcellular Location(s) cyto 19, cyto_nucl 11.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MVVDVIHPGLANVSKDELRAKIAKMYKAEKEVVSVFGFKTHFGGGKTTGFALIYDNLEALNKFEPRYRLVRYGLAEPPKGGRKQRKEKKNREKKFRGVKKTKKVRKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.19
4 0.18
5 0.2
6 0.22
7 0.22
8 0.26
9 0.31
10 0.34
11 0.37
12 0.41
13 0.41
14 0.42
15 0.44
16 0.36
17 0.34
18 0.31
19 0.28
20 0.24
21 0.2
22 0.16
23 0.16
24 0.17
25 0.14
26 0.14
27 0.12
28 0.13
29 0.12
30 0.14
31 0.13
32 0.14
33 0.14
34 0.12
35 0.12
36 0.1
37 0.09
38 0.09
39 0.08
40 0.07
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.08
48 0.08
49 0.09
50 0.12
51 0.14
52 0.17
53 0.22
54 0.25
55 0.27
56 0.28
57 0.32
58 0.32
59 0.34
60 0.37
61 0.36
62 0.33
63 0.29
64 0.32
65 0.34
66 0.36
67 0.41
68 0.45
69 0.52
70 0.63
71 0.72
72 0.79
73 0.83
74 0.9
75 0.93
76 0.94
77 0.94
78 0.94
79 0.93
80 0.93
81 0.93
82 0.92
83 0.92
84 0.92
85 0.92
86 0.92
87 0.94