Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BR24

Protein Details
Accession I1BR24    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
86-105TVSCKKTKPTCWHQSAKLPYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 9.833, mito_nucl 9.166, cyto 5, mito 4.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039856  EMC2-like  
Gene Ontology GO:0072546  C:EMC complex  
Amino Acid Sequences MSRFDFAKAIEELQQLRTTNERSSERITNIGQRIIDDNYTSKLGDQVWPFYEQVTIAALDTQNMTLANACDMKHKVCWMKHKKYMTVSCKKTKPTCWHQSAKLPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.25
3 0.25
4 0.28
5 0.27
6 0.26
7 0.32
8 0.32
9 0.31
10 0.36
11 0.39
12 0.36
13 0.38
14 0.36
15 0.37
16 0.36
17 0.35
18 0.29
19 0.25
20 0.26
21 0.23
22 0.22
23 0.15
24 0.14
25 0.14
26 0.14
27 0.13
28 0.11
29 0.11
30 0.11
31 0.14
32 0.14
33 0.14
34 0.15
35 0.17
36 0.16
37 0.15
38 0.14
39 0.1
40 0.1
41 0.08
42 0.07
43 0.05
44 0.06
45 0.05
46 0.05
47 0.06
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.06
54 0.07
55 0.08
56 0.09
57 0.13
58 0.14
59 0.16
60 0.17
61 0.22
62 0.27
63 0.31
64 0.42
65 0.48
66 0.56
67 0.63
68 0.68
69 0.69
70 0.71
71 0.76
72 0.76
73 0.76
74 0.75
75 0.76
76 0.76
77 0.78
78 0.76
79 0.75
80 0.75
81 0.75
82 0.78
83 0.78
84 0.8
85 0.77