Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BVA6

Protein Details
Accession I1BVA6   
Localization Confidence Low
Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
21-53QSSKTNKSSKTSKSSRTSKSSKTSKSSRTSRSSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15, cyto_nucl 11, nucl 5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027324  MAP2/MAP4/Tau  
IPR001084  MAP_tubulin-bd_rpt  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005874  C:microtubule  
GO:0008017  F:microtubule binding  
Pfam View protein in Pfam  
PF00418  Tubulin-binding  
PROSITE View protein in PROSITE  
PS00229  TAU_MAP_1  
PS51491  TAU_MAP_2  
Amino Acid Sequences MLAEPNSITKETEALSITSSQSSKTNKSSKTSKSSRTSKSSKTSKSSRTSRSSWSKLPNYPMPTYNNEELPPLPTKEPSTKLTYASKRASLVSPPSNLTDYSSSHVKSKVGSLDNIKHTPGGGNTKIFDEGVHVLKEKVVSKAAPKVGSLDNIKHKPGGGETKVFDEGVYALKEKITLKATSKTNIKHKPGGGTTRVFDEGIHTLKEKIVSKATSKVGSLDNIKHKPGGGKAKVFDEGVHVLKEKIAAKASSKVGSLDNIKHKPGGGEAKVFDEGIHVLKEKITSKATSKVGSLDNIKHKPGGGTTKVFDEGIHTLKEKIVSKATSKVGSLDNIKHKPGGGETKVFDEGVHVLKEKVVSKATSKVGSLDNIKHKPGGGTKKVFDEGVYALREKIVAKATSKIGSLDNIKHKLGGEDIRVYNGKDAKPKMITSKIGNSHKKYAGDTKEIVTKGKLLNEGCEKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.19
4 0.2
5 0.21
6 0.2
7 0.19
8 0.23
9 0.29
10 0.33
11 0.4
12 0.47
13 0.48
14 0.56
15 0.64
16 0.66
17 0.71
18 0.74
19 0.75
20 0.76
21 0.81
22 0.82
23 0.82
24 0.81
25 0.79
26 0.8
27 0.81
28 0.79
29 0.78
30 0.79
31 0.79
32 0.81
33 0.82
34 0.81
35 0.78
36 0.74
37 0.75
38 0.76
39 0.73
40 0.71
41 0.72
42 0.7
43 0.69
44 0.72
45 0.7
46 0.66
47 0.63
48 0.59
49 0.54
50 0.52
51 0.53
52 0.48
53 0.43
54 0.38
55 0.36
56 0.32
57 0.31
58 0.29
59 0.26
60 0.24
61 0.24
62 0.28
63 0.33
64 0.36
65 0.37
66 0.4
67 0.39
68 0.42
69 0.49
70 0.51
71 0.52
72 0.52
73 0.51
74 0.45
75 0.45
76 0.43
77 0.38
78 0.39
79 0.36
80 0.35
81 0.33
82 0.34
83 0.33
84 0.31
85 0.29
86 0.24
87 0.21
88 0.22
89 0.24
90 0.23
91 0.25
92 0.26
93 0.24
94 0.22
95 0.25
96 0.29
97 0.27
98 0.3
99 0.33
100 0.39
101 0.44
102 0.45
103 0.41
104 0.33
105 0.31
106 0.29
107 0.27
108 0.26
109 0.23
110 0.23
111 0.24
112 0.25
113 0.25
114 0.23
115 0.19
116 0.15
117 0.15
118 0.16
119 0.16
120 0.15
121 0.15
122 0.16
123 0.19
124 0.17
125 0.17
126 0.16
127 0.16
128 0.19
129 0.26
130 0.29
131 0.27
132 0.25
133 0.27
134 0.26
135 0.3
136 0.29
137 0.28
138 0.33
139 0.34
140 0.35
141 0.32
142 0.31
143 0.27
144 0.29
145 0.31
146 0.25
147 0.26
148 0.26
149 0.29
150 0.29
151 0.28
152 0.23
153 0.15
154 0.13
155 0.12
156 0.12
157 0.1
158 0.09
159 0.09
160 0.12
161 0.12
162 0.15
163 0.16
164 0.17
165 0.2
166 0.27
167 0.29
168 0.32
169 0.37
170 0.39
171 0.46
172 0.52
173 0.53
174 0.52
175 0.51
176 0.52
177 0.51
178 0.51
179 0.45
180 0.38
181 0.34
182 0.31
183 0.3
184 0.25
185 0.2
186 0.17
187 0.15
188 0.14
189 0.14
190 0.12
191 0.12
192 0.13
193 0.17
194 0.16
195 0.16
196 0.18
197 0.19
198 0.2
199 0.26
200 0.27
201 0.24
202 0.23
203 0.23
204 0.2
205 0.21
206 0.22
207 0.21
208 0.27
209 0.29
210 0.3
211 0.28
212 0.28
213 0.27
214 0.3
215 0.34
216 0.3
217 0.3
218 0.3
219 0.31
220 0.32
221 0.3
222 0.24
223 0.17
224 0.16
225 0.15
226 0.14
227 0.13
228 0.11
229 0.11
230 0.15
231 0.13
232 0.12
233 0.13
234 0.13
235 0.15
236 0.2
237 0.21
238 0.19
239 0.18
240 0.18
241 0.17
242 0.18
243 0.2
244 0.2
245 0.26
246 0.28
247 0.29
248 0.28
249 0.28
250 0.26
251 0.27
252 0.28
253 0.21
254 0.21
255 0.21
256 0.23
257 0.23
258 0.22
259 0.18
260 0.12
261 0.11
262 0.09
263 0.1
264 0.08
265 0.08
266 0.09
267 0.12
268 0.12
269 0.15
270 0.16
271 0.17
272 0.2
273 0.27
274 0.28
275 0.27
276 0.26
277 0.26
278 0.25
279 0.25
280 0.25
281 0.23
282 0.29
283 0.31
284 0.31
285 0.28
286 0.27
287 0.26
288 0.27
289 0.29
290 0.25
291 0.25
292 0.25
293 0.27
294 0.27
295 0.26
296 0.22
297 0.18
298 0.17
299 0.16
300 0.17
301 0.15
302 0.15
303 0.15
304 0.2
305 0.18
306 0.17
307 0.19
308 0.19
309 0.2
310 0.26
311 0.27
312 0.24
313 0.23
314 0.23
315 0.2
316 0.21
317 0.22
318 0.21
319 0.27
320 0.29
321 0.3
322 0.28
323 0.27
324 0.26
325 0.27
326 0.3
327 0.25
328 0.26
329 0.26
330 0.29
331 0.29
332 0.28
333 0.23
334 0.17
335 0.16
336 0.16
337 0.15
338 0.13
339 0.12
340 0.13
341 0.17
342 0.17
343 0.17
344 0.18
345 0.19
346 0.21
347 0.28
348 0.31
349 0.3
350 0.28
351 0.27
352 0.25
353 0.26
354 0.26
355 0.24
356 0.28
357 0.29
358 0.3
359 0.28
360 0.27
361 0.29
362 0.35
363 0.4
364 0.41
365 0.44
366 0.46
367 0.5
368 0.51
369 0.47
370 0.39
371 0.31
372 0.25
373 0.24
374 0.24
375 0.2
376 0.18
377 0.18
378 0.19
379 0.17
380 0.18
381 0.2
382 0.21
383 0.22
384 0.26
385 0.3
386 0.31
387 0.31
388 0.29
389 0.24
390 0.26
391 0.29
392 0.32
393 0.38
394 0.4
395 0.4
396 0.4
397 0.39
398 0.36
399 0.36
400 0.33
401 0.29
402 0.32
403 0.32
404 0.35
405 0.36
406 0.35
407 0.36
408 0.36
409 0.36
410 0.37
411 0.39
412 0.42
413 0.45
414 0.48
415 0.5
416 0.51
417 0.53
418 0.51
419 0.57
420 0.59
421 0.65
422 0.71
423 0.69
424 0.7
425 0.7
426 0.67
427 0.63
428 0.63
429 0.6
430 0.57
431 0.54
432 0.49
433 0.51
434 0.49
435 0.46
436 0.38
437 0.37
438 0.34
439 0.37
440 0.39
441 0.33
442 0.39