Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BRA3

Protein Details
Accession I1BRA3   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
53-79ALQDKERRKKWTPKRPSNKKKMGLCDEBasic
NLS Segment(s)
PositionSequence
57-73KERRKKWTPKRPSNKKK
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MDMLNSEYDKLAELQLKLSSRLKDDWEAQRKEQRASRKLDIEQRQVEFDQELALQDKERRKKWTPKRPSNKKKMGLCDELAGFLKNEEQLEIVNESDHTDVDTSILILPPSILESFWSLEIDPPVMRSEIEPTVNLLMKTKAELE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.22
3 0.23
4 0.26
5 0.3
6 0.29
7 0.29
8 0.31
9 0.33
10 0.33
11 0.39
12 0.45
13 0.5
14 0.52
15 0.54
16 0.59
17 0.58
18 0.59
19 0.57
20 0.56
21 0.54
22 0.57
23 0.57
24 0.56
25 0.58
26 0.62
27 0.64
28 0.62
29 0.6
30 0.53
31 0.49
32 0.43
33 0.39
34 0.3
35 0.22
36 0.15
37 0.1
38 0.1
39 0.09
40 0.09
41 0.09
42 0.14
43 0.21
44 0.27
45 0.31
46 0.37
47 0.43
48 0.54
49 0.63
50 0.7
51 0.74
52 0.78
53 0.85
54 0.9
55 0.93
56 0.93
57 0.92
58 0.89
59 0.83
60 0.8
61 0.75
62 0.68
63 0.58
64 0.49
65 0.39
66 0.32
67 0.27
68 0.19
69 0.13
70 0.09
71 0.09
72 0.08
73 0.08
74 0.07
75 0.06
76 0.06
77 0.08
78 0.09
79 0.08
80 0.07
81 0.07
82 0.08
83 0.08
84 0.08
85 0.07
86 0.06
87 0.06
88 0.07
89 0.06
90 0.06
91 0.06
92 0.07
93 0.06
94 0.06
95 0.06
96 0.05
97 0.07
98 0.07
99 0.06
100 0.07
101 0.09
102 0.1
103 0.11
104 0.11
105 0.1
106 0.12
107 0.13
108 0.14
109 0.12
110 0.12
111 0.13
112 0.13
113 0.13
114 0.12
115 0.15
116 0.18
117 0.2
118 0.19
119 0.2
120 0.24
121 0.26
122 0.25
123 0.23
124 0.21
125 0.2