Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1C061

Protein Details
Accession I1C061    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MTEEVQKKRSRRTVKHERAVVGHydrophilic
NLS Segment(s)
PositionSequence
8-19KRSRRTVKHERA
27-79AIRAKRNQKPDARAAARQAAIAKSKEAKKTAAAAKKANPAASQPKVSKQQAKG
Subcellular Location(s) nucl 13, mito 13, mito_nucl 13
Family & Domain DBs
Amino Acid Sequences MTEEVQKKRSRRTVKHERAVVGASWDAIRAKRNQKPDARAAARQAAIAKSKEAKKTAAAAKKANPAASQPKVSKQQAKGFAPKAAATSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.88
3 0.84
4 0.75
5 0.67
6 0.6
7 0.49
8 0.4
9 0.29
10 0.21
11 0.15
12 0.14
13 0.12
14 0.11
15 0.14
16 0.18
17 0.27
18 0.32
19 0.39
20 0.46
21 0.52
22 0.56
23 0.6
24 0.63
25 0.58
26 0.55
27 0.5
28 0.46
29 0.39
30 0.34
31 0.29
32 0.21
33 0.2
34 0.18
35 0.17
36 0.18
37 0.22
38 0.25
39 0.26
40 0.26
41 0.25
42 0.31
43 0.37
44 0.39
45 0.39
46 0.39
47 0.42
48 0.48
49 0.48
50 0.43
51 0.36
52 0.34
53 0.39
54 0.39
55 0.41
56 0.36
57 0.41
58 0.48
59 0.54
60 0.57
61 0.55
62 0.6
63 0.63
64 0.67
65 0.68
66 0.63
67 0.6
68 0.55
69 0.49