Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1C309

Protein Details
Accession I1C309   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
11-39KPSSSSGGKKAKKKWSAKKVKDKANNLVIHydrophilic
NLS Segment(s)
PositionSequence
11-33KPSSSSGGKKAKKKWSAKKVKDK
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MVSAKKDVAAKPSSSSGGKKAKKKWSAKKVKDKANNLVILDKPTYERLFKEVPTYKLISQSVLVDRLKLNGSLARIAIRELESQGLIKPISRHHAQIIYTRATGDEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.35
4 0.41
5 0.46
6 0.51
7 0.57
8 0.64
9 0.71
10 0.79
11 0.81
12 0.82
13 0.87
14 0.89
15 0.91
16 0.9
17 0.9
18 0.89
19 0.84
20 0.81
21 0.77
22 0.7
23 0.59
24 0.53
25 0.44
26 0.37
27 0.31
28 0.23
29 0.17
30 0.17
31 0.17
32 0.15
33 0.15
34 0.17
35 0.18
36 0.18
37 0.25
38 0.26
39 0.27
40 0.29
41 0.3
42 0.27
43 0.3
44 0.29
45 0.22
46 0.18
47 0.18
48 0.16
49 0.18
50 0.18
51 0.15
52 0.14
53 0.16
54 0.16
55 0.14
56 0.13
57 0.11
58 0.13
59 0.13
60 0.13
61 0.13
62 0.12
63 0.12
64 0.13
65 0.13
66 0.13
67 0.12
68 0.13
69 0.12
70 0.12
71 0.13
72 0.13
73 0.12
74 0.13
75 0.14
76 0.17
77 0.23
78 0.25
79 0.26
80 0.29
81 0.34
82 0.34
83 0.39
84 0.4
85 0.38
86 0.36
87 0.34