Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BZF0

Protein Details
Accession I1BZF0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSGSCKYMSKRRSKARIYTFAVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 8
Family & Domain DBs
Amino Acid Sequences MSGSCKYMSKRRSKARIYTFAVITRINLTKQKSSLLACVYNIYGGSERESPKALNAATGKMDQSNNNPTVTLLAVSQQHTRID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.84
4 0.8
5 0.74
6 0.66
7 0.59
8 0.53
9 0.43
10 0.34
11 0.28
12 0.24
13 0.21
14 0.23
15 0.23
16 0.24
17 0.25
18 0.26
19 0.25
20 0.25
21 0.26
22 0.24
23 0.22
24 0.18
25 0.18
26 0.16
27 0.14
28 0.12
29 0.1
30 0.08
31 0.07
32 0.09
33 0.12
34 0.13
35 0.14
36 0.15
37 0.15
38 0.15
39 0.18
40 0.15
41 0.16
42 0.16
43 0.17
44 0.18
45 0.18
46 0.18
47 0.18
48 0.2
49 0.18
50 0.22
51 0.28
52 0.28
53 0.27
54 0.27
55 0.24
56 0.24
57 0.22
58 0.17
59 0.1
60 0.12
61 0.14
62 0.17
63 0.2