Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BNU5

Protein Details
Accession I1BNU5   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
24-61LIYFDNKRRNDPNFKKQLKRERKKQTKAEKEIKKEELMHydrophilic
NLS Segment(s)
PositionSequence
32-56RNDPNFKKQLKRERKKQTKAEKEIK
Subcellular Location(s) cyto 10, cyto_nucl 7.5, E.R. 5, nucl 3, mito 3, extr 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002056  MAS20  
IPR023392  Tom20_dom_sf  
IPR002893  Znf_MYND  
Gene Ontology GO:0005742  C:mitochondrial outer membrane translocase complex  
GO:0046872  F:metal ion binding  
GO:0006605  P:protein targeting  
Pfam View protein in Pfam  
PF02064  MAS20  
PROSITE View protein in PROSITE  
PS01360  ZF_MYND_1  
PS50865  ZF_MYND_2  
Amino Acid Sequences MAVKPSTVALISTAIVATFGIGYLIYFDNKRRNDPNFKKQLKRERKKQTKAEKEIKKEELMTVEQLVQDVLKTVSQETFPEAPEEKEKYFMEQVAAGEALCQQGLLNESVPHFYKALKIYPAPLELVMIYQQTLPENVFRIVVNIMAVEQQKRQTEFYEQFPSEDVKLKLKELAQDDKVTHCLIAEQDFEENDVLYTETPLISALSPQLEGKYCNFCMNELKDVVECKNCDQVAFCSEACESAATKQYHQFLCTNNKLEPNAEQNKALDFVDYAKKQNLKYPYMIAKLFCVMVAEEVDKKNKPKYNSWDHIERMKGADLQPIDKYANESQMIKQLLSSKVPGIEEFLTDEIYLTLLSKLNANAYEVTSTDELSVGVKYTRPYPASFFVLIISIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.07
5 0.05
6 0.05
7 0.04
8 0.04
9 0.04
10 0.07
11 0.08
12 0.1
13 0.12
14 0.18
15 0.27
16 0.3
17 0.37
18 0.43
19 0.5
20 0.59
21 0.68
22 0.74
23 0.76
24 0.82
25 0.85
26 0.87
27 0.89
28 0.89
29 0.9
30 0.9
31 0.9
32 0.92
33 0.93
34 0.93
35 0.93
36 0.93
37 0.93
38 0.93
39 0.91
40 0.89
41 0.87
42 0.81
43 0.73
44 0.64
45 0.56
46 0.5
47 0.43
48 0.35
49 0.28
50 0.25
51 0.21
52 0.2
53 0.17
54 0.12
55 0.1
56 0.09
57 0.08
58 0.08
59 0.08
60 0.1
61 0.11
62 0.12
63 0.13
64 0.17
65 0.18
66 0.18
67 0.21
68 0.21
69 0.22
70 0.27
71 0.31
72 0.26
73 0.29
74 0.28
75 0.29
76 0.3
77 0.29
78 0.24
79 0.22
80 0.22
81 0.18
82 0.18
83 0.13
84 0.11
85 0.1
86 0.09
87 0.07
88 0.06
89 0.04
90 0.06
91 0.08
92 0.08
93 0.09
94 0.1
95 0.11
96 0.13
97 0.15
98 0.15
99 0.14
100 0.13
101 0.17
102 0.19
103 0.22
104 0.23
105 0.22
106 0.24
107 0.26
108 0.27
109 0.23
110 0.2
111 0.16
112 0.13
113 0.13
114 0.11
115 0.08
116 0.07
117 0.07
118 0.07
119 0.07
120 0.08
121 0.08
122 0.09
123 0.1
124 0.1
125 0.11
126 0.1
127 0.11
128 0.1
129 0.1
130 0.09
131 0.07
132 0.06
133 0.09
134 0.1
135 0.1
136 0.12
137 0.16
138 0.18
139 0.2
140 0.21
141 0.2
142 0.26
143 0.27
144 0.3
145 0.34
146 0.31
147 0.3
148 0.3
149 0.29
150 0.24
151 0.27
152 0.23
153 0.21
154 0.21
155 0.21
156 0.23
157 0.23
158 0.26
159 0.25
160 0.29
161 0.26
162 0.27
163 0.27
164 0.26
165 0.26
166 0.22
167 0.17
168 0.11
169 0.1
170 0.09
171 0.1
172 0.09
173 0.08
174 0.08
175 0.08
176 0.09
177 0.08
178 0.07
179 0.06
180 0.05
181 0.05
182 0.04
183 0.05
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.05
191 0.05
192 0.05
193 0.06
194 0.06
195 0.07
196 0.07
197 0.09
198 0.11
199 0.14
200 0.15
201 0.17
202 0.17
203 0.18
204 0.22
205 0.23
206 0.24
207 0.2
208 0.2
209 0.17
210 0.19
211 0.2
212 0.18
213 0.16
214 0.15
215 0.2
216 0.19
217 0.19
218 0.19
219 0.18
220 0.17
221 0.19
222 0.17
223 0.13
224 0.13
225 0.13
226 0.12
227 0.11
228 0.1
229 0.09
230 0.17
231 0.16
232 0.18
233 0.22
234 0.27
235 0.27
236 0.29
237 0.3
238 0.27
239 0.35
240 0.39
241 0.38
242 0.35
243 0.37
244 0.36
245 0.34
246 0.32
247 0.32
248 0.33
249 0.32
250 0.3
251 0.28
252 0.28
253 0.28
254 0.25
255 0.16
256 0.1
257 0.12
258 0.19
259 0.2
260 0.21
261 0.24
262 0.28
263 0.29
264 0.35
265 0.38
266 0.34
267 0.35
268 0.39
269 0.41
270 0.41
271 0.42
272 0.36
273 0.31
274 0.28
275 0.26
276 0.2
277 0.14
278 0.1
279 0.09
280 0.1
281 0.1
282 0.13
283 0.15
284 0.19
285 0.21
286 0.25
287 0.32
288 0.36
289 0.4
290 0.46
291 0.53
292 0.6
293 0.65
294 0.68
295 0.67
296 0.65
297 0.66
298 0.59
299 0.51
300 0.43
301 0.37
302 0.34
303 0.28
304 0.3
305 0.25
306 0.25
307 0.24
308 0.25
309 0.23
310 0.2
311 0.24
312 0.21
313 0.25
314 0.25
315 0.26
316 0.25
317 0.31
318 0.32
319 0.27
320 0.26
321 0.27
322 0.28
323 0.29
324 0.29
325 0.24
326 0.26
327 0.27
328 0.25
329 0.23
330 0.2
331 0.18
332 0.19
333 0.17
334 0.15
335 0.14
336 0.14
337 0.1
338 0.09
339 0.09
340 0.07
341 0.08
342 0.09
343 0.1
344 0.12
345 0.13
346 0.16
347 0.17
348 0.18
349 0.18
350 0.18
351 0.19
352 0.17
353 0.2
354 0.17
355 0.17
356 0.15
357 0.13
358 0.12
359 0.12
360 0.12
361 0.09
362 0.1
363 0.12
364 0.13
365 0.17
366 0.25
367 0.26
368 0.28
369 0.33
370 0.37
371 0.4
372 0.4
373 0.36
374 0.29