Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BW50

Protein Details
Accession I1BW50    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
55-80HIVPVKIGKKRKVDKGKTQQPKPKEQBasic
NLS Segment(s)
PositionSequence
61-78IGKKRKVDKGKTQQPKPK
Subcellular Location(s) mito 17, nucl 8, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MCDLNLRSFLIKHNIVVLNKDKRLKISYIATNSRAISVYAVVSFSVRVPSVHTTHIVPVKIGKKRKVDKGKTQQPKPKEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.36
4 0.39
5 0.39
6 0.43
7 0.47
8 0.42
9 0.4
10 0.43
11 0.4
12 0.37
13 0.36
14 0.37
15 0.39
16 0.42
17 0.4
18 0.39
19 0.37
20 0.33
21 0.27
22 0.2
23 0.14
24 0.11
25 0.09
26 0.07
27 0.07
28 0.06
29 0.05
30 0.05
31 0.05
32 0.06
33 0.06
34 0.06
35 0.09
36 0.12
37 0.14
38 0.15
39 0.16
40 0.16
41 0.2
42 0.24
43 0.22
44 0.18
45 0.23
46 0.29
47 0.35
48 0.42
49 0.45
50 0.51
51 0.59
52 0.7
53 0.74
54 0.76
55 0.8
56 0.84
57 0.88
58 0.89
59 0.91
60 0.89