Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BPY6

Protein Details
Accession I1BPY6   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
261-292DLTLRKPKAVQKKTNSNKKRKRENDKAEVVEAHydrophilic
NLS Segment(s)
PositionSequence
265-283RKPKAVQKKTNSNKKRKRE
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MSIYSVPEEYMHCFNVFDEIPDYEPMEVENINDLYQTTELEWHHWKGPNEDESVSEPAVKKLLDLKSYQVYRQILENEHHSKAEEQPITVEIQNDLKQSRKKIVSKKLEERIEPTHPNKYRSFLILLLKKDFLQEKQAQLLELLSEQHKIIEIQSITLSGLHRHLVLHASLTLEKLEAIVSSRNTLGNLQIRRDRVLEWKSDENMNWHKNCVFIDEAGFNMHIRRNFGRSKRGMPAKAVIPANRGITVSIIGAICEKGVIDLTLRKPKAVQKKTNSNKKRKRENDKAEVVEANARIGTRSEHFIEFLIGVMDTLDQFDMKGRYLVMDNAAIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.22
3 0.21
4 0.19
5 0.18
6 0.17
7 0.19
8 0.2
9 0.21
10 0.16
11 0.15
12 0.14
13 0.13
14 0.12
15 0.1
16 0.13
17 0.13
18 0.12
19 0.13
20 0.12
21 0.12
22 0.13
23 0.13
24 0.09
25 0.13
26 0.14
27 0.19
28 0.23
29 0.24
30 0.3
31 0.35
32 0.36
33 0.36
34 0.43
35 0.43
36 0.41
37 0.39
38 0.35
39 0.33
40 0.34
41 0.3
42 0.26
43 0.23
44 0.2
45 0.22
46 0.2
47 0.17
48 0.21
49 0.25
50 0.25
51 0.25
52 0.28
53 0.34
54 0.37
55 0.37
56 0.36
57 0.33
58 0.31
59 0.34
60 0.33
61 0.28
62 0.29
63 0.35
64 0.33
65 0.33
66 0.33
67 0.29
68 0.27
69 0.28
70 0.35
71 0.28
72 0.23
73 0.23
74 0.24
75 0.25
76 0.24
77 0.2
78 0.13
79 0.16
80 0.18
81 0.18
82 0.19
83 0.23
84 0.26
85 0.29
86 0.36
87 0.4
88 0.46
89 0.54
90 0.63
91 0.67
92 0.72
93 0.78
94 0.79
95 0.75
96 0.69
97 0.64
98 0.59
99 0.55
100 0.52
101 0.46
102 0.47
103 0.46
104 0.49
105 0.46
106 0.44
107 0.39
108 0.35
109 0.34
110 0.28
111 0.32
112 0.32
113 0.33
114 0.31
115 0.3
116 0.28
117 0.28
118 0.26
119 0.2
120 0.23
121 0.24
122 0.23
123 0.27
124 0.27
125 0.24
126 0.22
127 0.21
128 0.14
129 0.11
130 0.1
131 0.07
132 0.07
133 0.07
134 0.07
135 0.07
136 0.07
137 0.07
138 0.1
139 0.1
140 0.09
141 0.1
142 0.1
143 0.1
144 0.11
145 0.11
146 0.07
147 0.08
148 0.08
149 0.08
150 0.08
151 0.08
152 0.08
153 0.08
154 0.08
155 0.07
156 0.08
157 0.08
158 0.08
159 0.07
160 0.06
161 0.06
162 0.05
163 0.05
164 0.04
165 0.05
166 0.07
167 0.07
168 0.08
169 0.09
170 0.09
171 0.1
172 0.1
173 0.13
174 0.17
175 0.19
176 0.21
177 0.25
178 0.25
179 0.27
180 0.27
181 0.25
182 0.26
183 0.27
184 0.28
185 0.28
186 0.3
187 0.3
188 0.31
189 0.3
190 0.28
191 0.33
192 0.36
193 0.32
194 0.31
195 0.29
196 0.29
197 0.29
198 0.26
199 0.19
200 0.13
201 0.14
202 0.13
203 0.13
204 0.12
205 0.12
206 0.09
207 0.1
208 0.13
209 0.12
210 0.16
211 0.18
212 0.22
213 0.29
214 0.35
215 0.42
216 0.44
217 0.48
218 0.53
219 0.59
220 0.56
221 0.51
222 0.51
223 0.44
224 0.46
225 0.44
226 0.36
227 0.3
228 0.31
229 0.29
230 0.26
231 0.23
232 0.17
233 0.14
234 0.14
235 0.11
236 0.1
237 0.09
238 0.08
239 0.08
240 0.08
241 0.07
242 0.06
243 0.06
244 0.04
245 0.05
246 0.05
247 0.06
248 0.12
249 0.19
250 0.28
251 0.29
252 0.29
253 0.32
254 0.4
255 0.5
256 0.54
257 0.58
258 0.59
259 0.7
260 0.8
261 0.87
262 0.9
263 0.9
264 0.9
265 0.91
266 0.92
267 0.92
268 0.92
269 0.92
270 0.92
271 0.91
272 0.9
273 0.83
274 0.75
275 0.66
276 0.57
277 0.5
278 0.4
279 0.3
280 0.22
281 0.18
282 0.15
283 0.15
284 0.16
285 0.14
286 0.19
287 0.21
288 0.21
289 0.22
290 0.22
291 0.23
292 0.19
293 0.17
294 0.13
295 0.09
296 0.08
297 0.08
298 0.07
299 0.06
300 0.07
301 0.07
302 0.06
303 0.06
304 0.11
305 0.13
306 0.13
307 0.15
308 0.14
309 0.16
310 0.18
311 0.2
312 0.19