Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1CKM2

Protein Details
Accession I1CKM2    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
60-80RAKIKAKKPLLSKQHKERRLABasic
NLS Segment(s)
PositionSequence
60-80RAKIKAKKPLLSKQHKERRLA
Subcellular Location(s) nucl 17, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
Amino Acid Sequences MKAAPGRRATIGETTKSYIRRQVIKSEFKTAKAVHQYLNGLGYTIGYSAALKLLKSMNFRAKIKAKKPLLSKQHKERRLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.37
4 0.37
5 0.35
6 0.36
7 0.4
8 0.4
9 0.47
10 0.51
11 0.58
12 0.58
13 0.61
14 0.57
15 0.51
16 0.53
17 0.44
18 0.42
19 0.39
20 0.38
21 0.29
22 0.3
23 0.29
24 0.25
25 0.25
26 0.18
27 0.12
28 0.1
29 0.09
30 0.06
31 0.05
32 0.05
33 0.04
34 0.04
35 0.04
36 0.06
37 0.06
38 0.06
39 0.08
40 0.11
41 0.14
42 0.17
43 0.23
44 0.29
45 0.35
46 0.37
47 0.43
48 0.49
49 0.56
50 0.59
51 0.64
52 0.62
53 0.63
54 0.7
55 0.72
56 0.74
57 0.75
58 0.79
59 0.8
60 0.84