Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BUE6

Protein Details
Accession I1BUE6    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
168-191DDSEQESRKRHKEHNPRFRENDDEAcidic
NLS Segment(s)
Subcellular Location(s) nucl 22, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027157  NCBP2  
IPR012677  Nucleotide-bd_a/b_plait_sf  
Gene Ontology GO:0005846  C:nuclear cap binding complex  
GO:0005634  C:nucleus  
GO:0000339  F:RNA cap binding  
GO:0045292  P:mRNA cis splicing, via spliceosome  
Amino Acid Sequences MTTIINSLATPSSYRDQLYQMTFLQQQHFTLAICHSLQQKNKYTNFLASVEKLNVLSWDLIETKKHLVDSVLWNERIIRCDLDPGFKEGRQFGRGKSGGQVRDEYRTEYDAGRGGWGHRMRMELERNREKDIKENYEAIKEIPKGADEYVSRGSNMQGSSSKRKEMDDDSEQESRKRHKEHNPRFRENDDEDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.24
4 0.28
5 0.3
6 0.29
7 0.26
8 0.28
9 0.31
10 0.31
11 0.32
12 0.28
13 0.26
14 0.24
15 0.24
16 0.2
17 0.18
18 0.16
19 0.15
20 0.14
21 0.16
22 0.21
23 0.27
24 0.32
25 0.38
26 0.45
27 0.5
28 0.53
29 0.56
30 0.51
31 0.48
32 0.46
33 0.41
34 0.36
35 0.29
36 0.29
37 0.24
38 0.23
39 0.2
40 0.16
41 0.14
42 0.13
43 0.11
44 0.08
45 0.09
46 0.09
47 0.1
48 0.11
49 0.12
50 0.13
51 0.14
52 0.14
53 0.13
54 0.12
55 0.15
56 0.2
57 0.26
58 0.28
59 0.26
60 0.26
61 0.28
62 0.28
63 0.27
64 0.23
65 0.16
66 0.12
67 0.17
68 0.18
69 0.2
70 0.2
71 0.22
72 0.23
73 0.22
74 0.23
75 0.21
76 0.24
77 0.24
78 0.24
79 0.2
80 0.26
81 0.26
82 0.26
83 0.27
84 0.29
85 0.27
86 0.28
87 0.3
88 0.23
89 0.27
90 0.27
91 0.24
92 0.2
93 0.19
94 0.19
95 0.16
96 0.16
97 0.13
98 0.12
99 0.11
100 0.1
101 0.1
102 0.16
103 0.16
104 0.16
105 0.16
106 0.17
107 0.18
108 0.24
109 0.32
110 0.31
111 0.39
112 0.46
113 0.47
114 0.51
115 0.53
116 0.47
117 0.48
118 0.49
119 0.47
120 0.41
121 0.44
122 0.4
123 0.39
124 0.39
125 0.31
126 0.29
127 0.23
128 0.22
129 0.18
130 0.17
131 0.16
132 0.16
133 0.2
134 0.14
135 0.18
136 0.21
137 0.22
138 0.21
139 0.2
140 0.2
141 0.2
142 0.19
143 0.18
144 0.19
145 0.24
146 0.34
147 0.36
148 0.41
149 0.39
150 0.4
151 0.42
152 0.43
153 0.45
154 0.42
155 0.43
156 0.43
157 0.47
158 0.47
159 0.45
160 0.45
161 0.46
162 0.47
163 0.5
164 0.53
165 0.59
166 0.69
167 0.77
168 0.82
169 0.85
170 0.85
171 0.85
172 0.81
173 0.78
174 0.72