Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BZH4

Protein Details
Accession I1BZH4    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
75-98ELNLENYKKQRREKKKVVDKLLGKHydrophilic
NLS Segment(s)
PositionSequence
83-90KQRREKKK
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MNTDSSVLNVSINEAGINRLEAIKSEFSNLNSLLHNQPEPDIIEQKDSNGTSIIDLESTGQVIHKIQEGIESIHELNLENYKKQRREKKKVVDKLLGKLQHTGRLHYKVHEQIEHSESDLSDIQNNITQIQHTAIKLIDTLTTLEQQIDQVNLENEQREFELWKQNEENELINEIAIKKQLLKEKEMGLKQRYEEYEKIQQKKRLELYEATFNAELEEYKRKRETEISSLYPNSKTSSSLQTSLEQLQLLDHGNKEELEDFFGENEIKRSDRSKEVNSHLSSSEDERIDILHDEDYEDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.11
4 0.11
5 0.1
6 0.11
7 0.11
8 0.12
9 0.16
10 0.18
11 0.18
12 0.21
13 0.23
14 0.23
15 0.28
16 0.27
17 0.25
18 0.22
19 0.26
20 0.25
21 0.26
22 0.25
23 0.21
24 0.22
25 0.22
26 0.23
27 0.23
28 0.24
29 0.22
30 0.26
31 0.25
32 0.26
33 0.29
34 0.27
35 0.24
36 0.2
37 0.19
38 0.15
39 0.16
40 0.14
41 0.09
42 0.09
43 0.1
44 0.08
45 0.08
46 0.08
47 0.07
48 0.08
49 0.08
50 0.09
51 0.1
52 0.11
53 0.1
54 0.13
55 0.14
56 0.15
57 0.15
58 0.16
59 0.14
60 0.14
61 0.14
62 0.12
63 0.12
64 0.17
65 0.18
66 0.18
67 0.25
68 0.33
69 0.4
70 0.49
71 0.58
72 0.63
73 0.72
74 0.8
75 0.84
76 0.86
77 0.89
78 0.88
79 0.86
80 0.78
81 0.73
82 0.7
83 0.62
84 0.52
85 0.49
86 0.42
87 0.41
88 0.38
89 0.36
90 0.35
91 0.37
92 0.37
93 0.33
94 0.38
95 0.36
96 0.38
97 0.36
98 0.32
99 0.31
100 0.32
101 0.3
102 0.25
103 0.19
104 0.16
105 0.16
106 0.15
107 0.12
108 0.11
109 0.11
110 0.1
111 0.11
112 0.12
113 0.1
114 0.09
115 0.09
116 0.08
117 0.1
118 0.11
119 0.09
120 0.1
121 0.1
122 0.1
123 0.1
124 0.09
125 0.08
126 0.06
127 0.07
128 0.07
129 0.08
130 0.08
131 0.08
132 0.07
133 0.08
134 0.08
135 0.07
136 0.06
137 0.06
138 0.06
139 0.07
140 0.08
141 0.08
142 0.08
143 0.08
144 0.08
145 0.07
146 0.09
147 0.1
148 0.18
149 0.18
150 0.21
151 0.21
152 0.21
153 0.23
154 0.23
155 0.22
156 0.14
157 0.15
158 0.12
159 0.11
160 0.11
161 0.09
162 0.08
163 0.08
164 0.08
165 0.08
166 0.12
167 0.18
168 0.2
169 0.23
170 0.25
171 0.3
172 0.36
173 0.39
174 0.41
175 0.38
176 0.39
177 0.37
178 0.39
179 0.36
180 0.35
181 0.33
182 0.32
183 0.39
184 0.44
185 0.5
186 0.52
187 0.56
188 0.53
189 0.59
190 0.6
191 0.54
192 0.5
193 0.47
194 0.43
195 0.46
196 0.44
197 0.39
198 0.33
199 0.29
200 0.25
201 0.21
202 0.18
203 0.12
204 0.21
205 0.19
206 0.25
207 0.29
208 0.29
209 0.32
210 0.39
211 0.42
212 0.41
213 0.46
214 0.45
215 0.46
216 0.47
217 0.47
218 0.41
219 0.36
220 0.3
221 0.24
222 0.22
223 0.21
224 0.27
225 0.29
226 0.3
227 0.31
228 0.3
229 0.33
230 0.32
231 0.3
232 0.22
233 0.19
234 0.16
235 0.15
236 0.16
237 0.15
238 0.13
239 0.13
240 0.14
241 0.14
242 0.15
243 0.16
244 0.14
245 0.15
246 0.15
247 0.14
248 0.13
249 0.15
250 0.15
251 0.13
252 0.15
253 0.15
254 0.16
255 0.18
256 0.22
257 0.25
258 0.33
259 0.39
260 0.44
261 0.51
262 0.57
263 0.63
264 0.62
265 0.6
266 0.52
267 0.48
268 0.42
269 0.37
270 0.36
271 0.28
272 0.25
273 0.22
274 0.22
275 0.21
276 0.21
277 0.18
278 0.13
279 0.13