Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BND1

Protein Details
Accession I1BND1   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
113-144EDEERTAKRRAKRQKRNKKKQGKAVEEKTQEKBasic
NLS Segment(s)
PositionSequence
117-171RTAKRRAKRQKRNKKKQGKAVEEKTQEKKEEEKKVEEKEKKEEKTEENSEKKEDK
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSASENNNTKGPNRYNLTPAQIQQKELEKLFEKIDKPVQIPTPLPKEKNVIPPPKDFVRNVSGSSAGAGSGDFHVYRAQRRREYARMKNMEDQERQEREENEYKNRLARLREEDEERTAKRRAKRQKRNKKKQGKAVEEKTQEKKEEEKKVEEKEKKEEKTEENSEKKEDKKLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.47
3 0.5
4 0.53
5 0.48
6 0.47
7 0.49
8 0.45
9 0.43
10 0.42
11 0.45
12 0.43
13 0.39
14 0.41
15 0.33
16 0.33
17 0.35
18 0.36
19 0.3
20 0.31
21 0.36
22 0.35
23 0.34
24 0.36
25 0.36
26 0.34
27 0.35
28 0.37
29 0.4
30 0.42
31 0.42
32 0.4
33 0.41
34 0.42
35 0.5
36 0.52
37 0.52
38 0.5
39 0.52
40 0.55
41 0.55
42 0.54
43 0.44
44 0.4
45 0.36
46 0.34
47 0.32
48 0.28
49 0.23
50 0.19
51 0.19
52 0.14
53 0.08
54 0.07
55 0.06
56 0.05
57 0.05
58 0.06
59 0.05
60 0.06
61 0.08
62 0.1
63 0.16
64 0.23
65 0.29
66 0.32
67 0.36
68 0.42
69 0.48
70 0.56
71 0.58
72 0.61
73 0.6
74 0.59
75 0.61
76 0.6
77 0.56
78 0.49
79 0.45
80 0.42
81 0.39
82 0.38
83 0.35
84 0.31
85 0.32
86 0.37
87 0.36
88 0.34
89 0.36
90 0.34
91 0.34
92 0.36
93 0.34
94 0.29
95 0.32
96 0.33
97 0.34
98 0.37
99 0.38
100 0.37
101 0.39
102 0.41
103 0.37
104 0.34
105 0.34
106 0.36
107 0.39
108 0.46
109 0.53
110 0.6
111 0.7
112 0.77
113 0.83
114 0.9
115 0.95
116 0.96
117 0.96
118 0.94
119 0.94
120 0.93
121 0.92
122 0.91
123 0.87
124 0.86
125 0.82
126 0.8
127 0.77
128 0.72
129 0.64
130 0.57
131 0.58
132 0.57
133 0.6
134 0.58
135 0.59
136 0.61
137 0.67
138 0.75
139 0.74
140 0.7
141 0.7
142 0.74
143 0.7
144 0.7
145 0.67
146 0.63
147 0.64
148 0.69
149 0.69
150 0.67
151 0.66
152 0.66
153 0.66
154 0.63