Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1C103

Protein Details
Accession I1C103    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
10-37VSVHKPRVTARHRKSRLRWTKEHPNWTEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 8, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MKLAKLDVFVSVHKPRVTARHRKSRLRWTKEHPNWTEDQWRSVVWSDESRFCVEGNQEACINILVNRFHPWLTNVTMHQEKDLIFQEDRASCHTGSYAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.38
4 0.45
5 0.49
6 0.54
7 0.6
8 0.68
9 0.77
10 0.82
11 0.83
12 0.85
13 0.83
14 0.81
15 0.79
16 0.82
17 0.81
18 0.82
19 0.73
20 0.66
21 0.6
22 0.56
23 0.56
24 0.45
25 0.39
26 0.3
27 0.27
28 0.24
29 0.23
30 0.21
31 0.14
32 0.17
33 0.17
34 0.18
35 0.2
36 0.19
37 0.18
38 0.17
39 0.16
40 0.13
41 0.16
42 0.14
43 0.14
44 0.13
45 0.13
46 0.13
47 0.12
48 0.11
49 0.08
50 0.11
51 0.1
52 0.11
53 0.14
54 0.15
55 0.15
56 0.15
57 0.16
58 0.16
59 0.19
60 0.21
61 0.19
62 0.25
63 0.29
64 0.28
65 0.27
66 0.25
67 0.22
68 0.24
69 0.26
70 0.24
71 0.2
72 0.21
73 0.26
74 0.27
75 0.29
76 0.28
77 0.28
78 0.23
79 0.24