Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BQM3

Protein Details
Accession I1BQM3    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
53-82KEYLEAKKKKKIESRKQKLKSKNERPVEVEBasic
NLS Segment(s)
PositionSequence
15-91KEAKKLAKRLKVAKVLEEKEQQKELKKEEKKDELEQVKKEYLEAKKKKKIESRKQKLKSKNERPVEVEEKKVKKRVR
Subcellular Location(s) nucl 18.5, cyto_nucl 12.333, mito_nucl 12.166, mito 4.5
Family & Domain DBs
Amino Acid Sequences MFELIQKASQKEDEKEAKKLAKRLKVAKVLEEKEQQKELKKEEKKDELEQVKKEYLEAKKKKKIESRKQKLKSKNERPVEVEEKKVKKRVRFAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.51
3 0.54
4 0.54
5 0.54
6 0.59
7 0.59
8 0.57
9 0.61
10 0.64
11 0.66
12 0.67
13 0.64
14 0.63
15 0.64
16 0.58
17 0.56
18 0.55
19 0.49
20 0.44
21 0.47
22 0.42
23 0.4
24 0.42
25 0.42
26 0.44
27 0.47
28 0.51
29 0.53
30 0.59
31 0.57
32 0.55
33 0.58
34 0.55
35 0.55
36 0.5
37 0.46
38 0.39
39 0.35
40 0.33
41 0.31
42 0.3
43 0.36
44 0.43
45 0.49
46 0.55
47 0.6
48 0.68
49 0.71
50 0.75
51 0.76
52 0.79
53 0.8
54 0.84
55 0.89
56 0.9
57 0.9
58 0.9
59 0.9
60 0.9
61 0.89
62 0.86
63 0.82
64 0.77
65 0.75
66 0.73
67 0.66
68 0.64
69 0.63
70 0.63
71 0.65
72 0.69
73 0.67
74 0.66