Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1CHB1

Protein Details
Accession I1CHB1    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
30-54FGNNNPFSKKKTRRNWLPNVQNKNLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 12, mito_nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR034704  L28p-like  
IPR026569  Ribo_L28/L24  
IPR037147  Ribo_L28/L24_sf  
IPR001383  Ribosomal_L28  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00830  Ribosomal_L28  
Amino Acid Sequences MLSAEPAYALARATFKRAQRGLFGGKHIQFGNNNPFSKKKTRRNWLPNVQNKNLYSETLSKFIEVKVTTSVLRTIDKKGGLDKYLMETKDKNLFSEKALELKAKIRNQQKIQAKAVAKTEAKQQAPNTVVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.37
4 0.4
5 0.4
6 0.4
7 0.45
8 0.47
9 0.44
10 0.45
11 0.43
12 0.41
13 0.42
14 0.38
15 0.36
16 0.3
17 0.33
18 0.39
19 0.37
20 0.38
21 0.37
22 0.4
23 0.42
24 0.51
25 0.55
26 0.56
27 0.59
28 0.69
29 0.77
30 0.83
31 0.88
32 0.88
33 0.88
34 0.87
35 0.85
36 0.77
37 0.72
38 0.62
39 0.57
40 0.47
41 0.37
42 0.3
43 0.28
44 0.27
45 0.24
46 0.23
47 0.19
48 0.19
49 0.18
50 0.19
51 0.14
52 0.13
53 0.11
54 0.12
55 0.12
56 0.12
57 0.13
58 0.11
59 0.13
60 0.14
61 0.15
62 0.17
63 0.18
64 0.18
65 0.21
66 0.22
67 0.21
68 0.2
69 0.18
70 0.19
71 0.23
72 0.23
73 0.21
74 0.2
75 0.22
76 0.3
77 0.29
78 0.26
79 0.26
80 0.27
81 0.26
82 0.31
83 0.28
84 0.24
85 0.25
86 0.25
87 0.23
88 0.27
89 0.34
90 0.32
91 0.39
92 0.44
93 0.52
94 0.56
95 0.64
96 0.67
97 0.67
98 0.66
99 0.67
100 0.61
101 0.56
102 0.54
103 0.53
104 0.45
105 0.39
106 0.44
107 0.45
108 0.44
109 0.46
110 0.44
111 0.45