Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CKK2

Protein Details
Accession I1CKK2   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
135-162AATYPSLAKPKKRSRQRKRKMASDSSSVHydrophilic
NLS Segment(s)
PositionSequence
143-154KPKKRSRQRKRK
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MTDTTRQRTDLKVLTTEYLSTAQTAVAQVRQKASHMVTSAKSLMPQVSVPPLDALSTVMFSPLAAHPVYRSESMMRAMQIMQQQQRGSTTSTAIARPRSDLVLHGTSYAWPSSVALLEEDIPESNEPVSLFQGFAATYPSLAKPKKRSRQRKRKMASDSSSVYSQERKEGEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.32
4 0.26
5 0.22
6 0.18
7 0.15
8 0.13
9 0.11
10 0.11
11 0.12
12 0.11
13 0.14
14 0.17
15 0.19
16 0.22
17 0.23
18 0.23
19 0.26
20 0.27
21 0.25
22 0.24
23 0.26
24 0.23
25 0.26
26 0.27
27 0.22
28 0.21
29 0.18
30 0.17
31 0.15
32 0.14
33 0.12
34 0.14
35 0.14
36 0.14
37 0.13
38 0.13
39 0.12
40 0.11
41 0.11
42 0.07
43 0.08
44 0.07
45 0.06
46 0.06
47 0.06
48 0.08
49 0.07
50 0.08
51 0.07
52 0.08
53 0.08
54 0.1
55 0.13
56 0.11
57 0.12
58 0.11
59 0.13
60 0.15
61 0.16
62 0.13
63 0.12
64 0.12
65 0.14
66 0.16
67 0.18
68 0.18
69 0.2
70 0.2
71 0.2
72 0.2
73 0.19
74 0.17
75 0.14
76 0.12
77 0.12
78 0.13
79 0.15
80 0.16
81 0.17
82 0.16
83 0.17
84 0.17
85 0.16
86 0.15
87 0.14
88 0.17
89 0.17
90 0.16
91 0.15
92 0.14
93 0.14
94 0.15
95 0.13
96 0.09
97 0.06
98 0.07
99 0.07
100 0.07
101 0.07
102 0.06
103 0.07
104 0.07
105 0.07
106 0.08
107 0.07
108 0.08
109 0.07
110 0.08
111 0.07
112 0.08
113 0.08
114 0.08
115 0.1
116 0.09
117 0.09
118 0.08
119 0.09
120 0.08
121 0.08
122 0.1
123 0.08
124 0.08
125 0.1
126 0.12
127 0.19
128 0.23
129 0.31
130 0.38
131 0.49
132 0.59
133 0.69
134 0.78
135 0.82
136 0.9
137 0.94
138 0.94
139 0.92
140 0.92
141 0.9
142 0.89
143 0.83
144 0.8
145 0.73
146 0.66
147 0.59
148 0.51
149 0.43
150 0.38
151 0.34
152 0.33