Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CH26

Protein Details
Accession I1CH26    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
87-107QIDEPKFGKRKYKRRSRRDEFBasic
NLS Segment(s)
PositionSequence
93-104FGKRKYKRRSRR
Subcellular Location(s) nucl 19.5, mito_nucl 13, mito 5.5
Family & Domain DBs
Amino Acid Sequences MVPRYRRSKFQFYYRCRTPSSVGLHNDRQESITKGSIFSNKKSDIIRISGPTASQLAIDWQMLMHNNFIRYFGDFKLGDNELYDHIQIDEPKFGKRKYKRRSRRDEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.74
3 0.67
4 0.64
5 0.57
6 0.54
7 0.52
8 0.5
9 0.47
10 0.49
11 0.51
12 0.51
13 0.48
14 0.41
15 0.36
16 0.3
17 0.29
18 0.25
19 0.24
20 0.2
21 0.2
22 0.22
23 0.28
24 0.28
25 0.28
26 0.31
27 0.28
28 0.31
29 0.31
30 0.32
31 0.27
32 0.27
33 0.26
34 0.22
35 0.22
36 0.19
37 0.18
38 0.16
39 0.14
40 0.11
41 0.08
42 0.07
43 0.06
44 0.07
45 0.07
46 0.06
47 0.05
48 0.06
49 0.07
50 0.08
51 0.09
52 0.09
53 0.11
54 0.11
55 0.12
56 0.12
57 0.13
58 0.15
59 0.13
60 0.17
61 0.16
62 0.17
63 0.21
64 0.21
65 0.19
66 0.18
67 0.18
68 0.15
69 0.16
70 0.15
71 0.11
72 0.11
73 0.14
74 0.15
75 0.15
76 0.2
77 0.2
78 0.26
79 0.31
80 0.34
81 0.42
82 0.5
83 0.59
84 0.64
85 0.74
86 0.79
87 0.85