Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CJY4

Protein Details
Accession I1CJY4    Localization Confidence High Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
239-266KKVPAWKQKMLDKKNKNKKQPETATLNEHydrophilic
NLS Segment(s)
PositionSequence
247-247K
249-256LDKKNKNK
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR039905  CD2BP2/Lin1  
Gene Ontology GO:0005682  C:U5 snRNP  
Amino Acid Sequences MKRNFDTRNQGSSSKRVRFDSNTRGSSTDDFEFNHEDALEEKKSRRGAVNFDVYGSDDEEVGYSSGDSDDEGNKKEEEEKAPAIEEDFDMFNEAPDVNGKSKINPNKEIEGQDFTSFDRDDEEEDDIENGVKKEGKITAFNMKAELEEGSLDEKGNYIRNKEDPQAFHDKWMEGITRKDINHAKAAQEKREREEALKEAERQSNLPQTQTDIYRALVEYLQPGQSVQEALTSLANSLPKKVPAWKQKMLDKKNKNKKQPETATLNEEEEAARRKKVEIITELADQMMALGYFNVYEDTFEIMVRHLRKEGAVPQDWTPSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.61
3 0.57
4 0.6
5 0.62
6 0.66
7 0.67
8 0.67
9 0.62
10 0.59
11 0.57
12 0.54
13 0.48
14 0.43
15 0.35
16 0.28
17 0.25
18 0.26
19 0.29
20 0.25
21 0.24
22 0.19
23 0.17
24 0.16
25 0.2
26 0.2
27 0.2
28 0.22
29 0.27
30 0.3
31 0.32
32 0.38
33 0.38
34 0.42
35 0.46
36 0.53
37 0.47
38 0.45
39 0.42
40 0.36
41 0.33
42 0.26
43 0.19
44 0.1
45 0.1
46 0.09
47 0.09
48 0.08
49 0.07
50 0.05
51 0.06
52 0.06
53 0.06
54 0.06
55 0.07
56 0.11
57 0.14
58 0.16
59 0.18
60 0.18
61 0.19
62 0.22
63 0.25
64 0.24
65 0.27
66 0.27
67 0.26
68 0.27
69 0.26
70 0.23
71 0.19
72 0.15
73 0.12
74 0.1
75 0.09
76 0.11
77 0.1
78 0.09
79 0.09
80 0.09
81 0.07
82 0.09
83 0.12
84 0.11
85 0.15
86 0.15
87 0.18
88 0.27
89 0.34
90 0.39
91 0.43
92 0.45
93 0.45
94 0.49
95 0.48
96 0.43
97 0.39
98 0.34
99 0.28
100 0.25
101 0.21
102 0.2
103 0.17
104 0.14
105 0.12
106 0.11
107 0.12
108 0.13
109 0.14
110 0.11
111 0.11
112 0.12
113 0.1
114 0.1
115 0.09
116 0.08
117 0.07
118 0.09
119 0.08
120 0.1
121 0.13
122 0.15
123 0.16
124 0.18
125 0.25
126 0.26
127 0.26
128 0.25
129 0.22
130 0.2
131 0.18
132 0.16
133 0.08
134 0.06
135 0.06
136 0.06
137 0.06
138 0.06
139 0.06
140 0.06
141 0.07
142 0.12
143 0.12
144 0.13
145 0.15
146 0.18
147 0.21
148 0.24
149 0.28
150 0.24
151 0.28
152 0.36
153 0.34
154 0.34
155 0.33
156 0.29
157 0.25
158 0.26
159 0.22
160 0.14
161 0.16
162 0.17
163 0.19
164 0.19
165 0.25
166 0.27
167 0.28
168 0.32
169 0.31
170 0.3
171 0.34
172 0.37
173 0.39
174 0.42
175 0.42
176 0.4
177 0.45
178 0.43
179 0.37
180 0.38
181 0.33
182 0.32
183 0.33
184 0.31
185 0.3
186 0.32
187 0.31
188 0.28
189 0.28
190 0.3
191 0.28
192 0.27
193 0.23
194 0.23
195 0.25
196 0.25
197 0.24
198 0.17
199 0.17
200 0.17
201 0.16
202 0.14
203 0.12
204 0.11
205 0.11
206 0.11
207 0.11
208 0.1
209 0.1
210 0.09
211 0.1
212 0.1
213 0.08
214 0.07
215 0.07
216 0.08
217 0.09
218 0.09
219 0.08
220 0.1
221 0.14
222 0.12
223 0.16
224 0.17
225 0.18
226 0.21
227 0.28
228 0.35
229 0.42
230 0.5
231 0.54
232 0.58
233 0.64
234 0.73
235 0.75
236 0.76
237 0.77
238 0.79
239 0.83
240 0.86
241 0.89
242 0.89
243 0.89
244 0.89
245 0.87
246 0.84
247 0.81
248 0.75
249 0.7
250 0.62
251 0.54
252 0.43
253 0.35
254 0.27
255 0.22
256 0.25
257 0.22
258 0.21
259 0.21
260 0.22
261 0.27
262 0.31
263 0.35
264 0.32
265 0.35
266 0.37
267 0.37
268 0.36
269 0.3
270 0.26
271 0.18
272 0.14
273 0.1
274 0.06
275 0.05
276 0.04
277 0.05
278 0.05
279 0.05
280 0.07
281 0.06
282 0.07
283 0.08
284 0.11
285 0.11
286 0.12
287 0.12
288 0.12
289 0.19
290 0.21
291 0.23
292 0.21
293 0.22
294 0.23
295 0.28
296 0.34
297 0.36
298 0.38
299 0.39
300 0.4