Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BY19

Protein Details
Accession I1BY19    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-54MPSPSRSYRRSRSRSRSRSPYRGRSSYRNRSPRRSRSPHERRRRSPLRTGRRSSHydrophilic
NLS Segment(s)
PositionSequence
9-63RRSRSRSRSRSPYRGRSSYRNRSPRRSRSPHERRRRSPLRTGRRSSPPHRSGQKR
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MPSPSRSYRRSRSRSRSRSPYRGRSSYRNRSPRRSRSPHERRRRSPLRTGRRSSPPHRSGQKRYQWGREEEEEKKEEEPVEKEQPNFGLSGKLAAETNTVKGVELKYNEPPEAAKPKQKWRLYVFKGKEQVGRDRVVKVNKEVMND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.91
3 0.91
4 0.9
5 0.92
6 0.91
7 0.9
8 0.88
9 0.87
10 0.83
11 0.82
12 0.83
13 0.83
14 0.83
15 0.83
16 0.81
17 0.83
18 0.88
19 0.88
20 0.88
21 0.86
22 0.84
23 0.84
24 0.88
25 0.88
26 0.89
27 0.89
28 0.85
29 0.86
30 0.88
31 0.83
32 0.82
33 0.82
34 0.82
35 0.81
36 0.79
37 0.76
38 0.76
39 0.77
40 0.73
41 0.73
42 0.67
43 0.66
44 0.69
45 0.69
46 0.68
47 0.7
48 0.72
49 0.7
50 0.7
51 0.7
52 0.66
53 0.62
54 0.58
55 0.53
56 0.5
57 0.43
58 0.43
59 0.35
60 0.31
61 0.28
62 0.24
63 0.2
64 0.18
65 0.18
66 0.18
67 0.24
68 0.25
69 0.25
70 0.25
71 0.25
72 0.23
73 0.21
74 0.16
75 0.11
76 0.09
77 0.1
78 0.1
79 0.09
80 0.09
81 0.09
82 0.11
83 0.1
84 0.11
85 0.11
86 0.11
87 0.1
88 0.12
89 0.14
90 0.16
91 0.17
92 0.19
93 0.24
94 0.27
95 0.27
96 0.25
97 0.25
98 0.27
99 0.33
100 0.34
101 0.37
102 0.4
103 0.51
104 0.6
105 0.63
106 0.65
107 0.64
108 0.71
109 0.7
110 0.74
111 0.69
112 0.68
113 0.7
114 0.66
115 0.64
116 0.57
117 0.59
118 0.53
119 0.53
120 0.47
121 0.46
122 0.49
123 0.52
124 0.52
125 0.47
126 0.52