Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1CU77

Protein Details
Accession I1CU77    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
60-80RAKIKAKKPLLSKQHKERRLABasic
NLS Segment(s)
PositionSequence
60-78RAKIKAKKPLLSKQHKERR
Subcellular Location(s) mito 12, cyto 8, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002492  Transposase_Tc1-like  
Gene Ontology GO:0003677  F:DNA binding  
GO:0015074  P:DNA integration  
GO:0006313  P:DNA transposition  
Pfam View protein in Pfam  
PF01498  HTH_Tnp_Tc3_2  
Amino Acid Sequences MKAAPGRRATIGETTKSYIRRQVIKGEFKTAKAVHQYLNGLGYTIGYSGVLKLLKSMNFRAKIKAKKPLLSKQHKERRLAWAMAHKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.38
4 0.37
5 0.35
6 0.37
7 0.4
8 0.4
9 0.47
10 0.51
11 0.57
12 0.56
13 0.58
14 0.54
15 0.48
16 0.52
17 0.42
18 0.37
19 0.33
20 0.33
21 0.25
22 0.26
23 0.26
24 0.2
25 0.21
26 0.17
27 0.12
28 0.11
29 0.09
30 0.06
31 0.05
32 0.05
33 0.04
34 0.04
35 0.03
36 0.06
37 0.06
38 0.06
39 0.07
40 0.1
41 0.13
42 0.16
43 0.21
44 0.27
45 0.33
46 0.34
47 0.4
48 0.47
49 0.53
50 0.56
51 0.61
52 0.59
53 0.6
54 0.67
55 0.69
56 0.71
57 0.73
58 0.76
59 0.78
60 0.82
61 0.82
62 0.8
63 0.75
64 0.74
65 0.71
66 0.64
67 0.59